Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WHK1

Protein Details
Accession Q4WHK1    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
82-102DDQPKPKNKARKETDRGRGRGBasic
NLS Segment(s)
PositionSequence
86-120KPKNKARKETDRGRGRGGARGGRGRGRGRGRGRGF
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, mito 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR034102  Sm_D1  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0071013  C:catalytic step 2 spliceosome  
GO:0000243  C:commitment complex  
GO:0034715  C:pICln-Sm protein complex  
GO:0071011  C:precatalytic spliceosome  
GO:0034719  C:SMN-Sm protein complex  
GO:0097526  C:spliceosomal tri-snRNP complex  
GO:0005685  C:U1 snRNP  
GO:0005686  C:U2 snRNP  
GO:0005687  C:U4 snRNP  
GO:0005682  C:U5 snRNP  
GO:0003723  F:RNA binding  
GO:0000387  P:spliceosomal snRNP assembly  
GO:0008033  P:tRNA processing  
KEGG afm:AFUA_2G05110  -  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01724  Sm_D1  
Amino Acid Sequences MKLVRFLMKCANETVTIELKNGTILHGTITAVSPQMNTSLRTVKMTPKGRDPISLDTINIRGSTIRYYILPDSLPLDTLLVDDQPKPKNKARKETDRGRGRGGARGGRGRGRGRGRGRGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.28
3 0.25
4 0.23
5 0.21
6 0.19
7 0.19
8 0.17
9 0.14
10 0.1
11 0.09
12 0.1
13 0.1
14 0.1
15 0.09
16 0.09
17 0.09
18 0.08
19 0.08
20 0.08
21 0.07
22 0.11
23 0.11
24 0.12
25 0.14
26 0.18
27 0.19
28 0.21
29 0.22
30 0.25
31 0.33
32 0.4
33 0.39
34 0.42
35 0.47
36 0.45
37 0.48
38 0.45
39 0.41
40 0.38
41 0.36
42 0.29
43 0.24
44 0.24
45 0.21
46 0.17
47 0.12
48 0.07
49 0.08
50 0.09
51 0.08
52 0.08
53 0.08
54 0.1
55 0.11
56 0.11
57 0.11
58 0.1
59 0.11
60 0.1
61 0.11
62 0.08
63 0.08
64 0.07
65 0.07
66 0.07
67 0.06
68 0.07
69 0.09
70 0.14
71 0.2
72 0.25
73 0.31
74 0.38
75 0.46
76 0.53
77 0.62
78 0.66
79 0.72
80 0.76
81 0.8
82 0.84
83 0.84
84 0.79
85 0.73
86 0.7
87 0.61
88 0.58
89 0.54
90 0.49
91 0.45
92 0.49
93 0.48
94 0.47
95 0.53
96 0.5
97 0.53
98 0.55
99 0.59
100 0.59