Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3GS92

Protein Details
Accession A0A0C3GS92    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
47-80NKCKTCQKIDTKKQSIRKKKERIKRWNRESGWRAHydrophilic
NLS Segment(s)
PositionSequence
58-74KKQSIRKKKERIKRWNR
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MCFYNQIRLACGDYKWGHLRQQCSKEYRPGETCGMRLVMEAIEISDNKCKTCQKIDTKKQSIRKKKERIKRWNRESGWRALIEKAEEDIYRLELEILNLEGER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.34
4 0.37
5 0.39
6 0.47
7 0.49
8 0.55
9 0.56
10 0.58
11 0.59
12 0.61
13 0.6
14 0.59
15 0.53
16 0.49
17 0.48
18 0.43
19 0.39
20 0.31
21 0.29
22 0.22
23 0.19
24 0.15
25 0.09
26 0.08
27 0.07
28 0.06
29 0.06
30 0.06
31 0.07
32 0.11
33 0.11
34 0.11
35 0.14
36 0.16
37 0.18
38 0.23
39 0.31
40 0.37
41 0.47
42 0.57
43 0.65
44 0.72
45 0.76
46 0.79
47 0.81
48 0.82
49 0.82
50 0.82
51 0.83
52 0.84
53 0.87
54 0.89
55 0.9
56 0.9
57 0.91
58 0.89
59 0.89
60 0.83
61 0.83
62 0.77
63 0.73
64 0.66
65 0.57
66 0.49
67 0.41
68 0.4
69 0.31
70 0.27
71 0.21
72 0.19
73 0.17
74 0.17
75 0.16
76 0.15
77 0.14
78 0.13
79 0.12
80 0.1
81 0.11
82 0.11
83 0.11