Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3CSH0

Protein Details
Accession A0A0C3CSH0    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
84-121DLRSKQTRAIRRRLTKHERGQKLLKTKKRETHFPQRKFBasic
NLS Segment(s)
PositionSequence
87-120SKQTRAIRRRLTKHERGQKLLKTKKRETHFPQRK
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSTGKVKAGQLWSKNKEDLNKQLVELKTELGQLRTQKIAGGSASKLTKIHDLRKSIARVLTVINANQRAQLRLFYKGKKYLPLDLRSKQTRAIRRRLTKHERGQKLLKTKKRETHFPQRKFAIKAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.57
3 0.56
4 0.56
5 0.56
6 0.53
7 0.48
8 0.44
9 0.48
10 0.45
11 0.41
12 0.34
13 0.26
14 0.21
15 0.23
16 0.24
17 0.18
18 0.21
19 0.21
20 0.23
21 0.23
22 0.21
23 0.19
24 0.18
25 0.18
26 0.16
27 0.15
28 0.13
29 0.16
30 0.16
31 0.15
32 0.15
33 0.15
34 0.22
35 0.24
36 0.31
37 0.33
38 0.35
39 0.38
40 0.44
41 0.44
42 0.39
43 0.36
44 0.28
45 0.23
46 0.21
47 0.21
48 0.16
49 0.15
50 0.15
51 0.15
52 0.14
53 0.17
54 0.17
55 0.15
56 0.14
57 0.18
58 0.17
59 0.23
60 0.27
61 0.28
62 0.33
63 0.38
64 0.39
65 0.42
66 0.43
67 0.44
68 0.47
69 0.5
70 0.51
71 0.49
72 0.55
73 0.52
74 0.51
75 0.49
76 0.5
77 0.52
78 0.53
79 0.59
80 0.62
81 0.67
82 0.75
83 0.79
84 0.81
85 0.81
86 0.84
87 0.84
88 0.81
89 0.79
90 0.78
91 0.75
92 0.76
93 0.76
94 0.74
95 0.73
96 0.75
97 0.77
98 0.76
99 0.79
100 0.77
101 0.79
102 0.82
103 0.8
104 0.79
105 0.78
106 0.78
107 0.72