Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3HAI5

Protein Details
Accession A0A0C3HAI5   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
96-122LQTKNHRGSTRRKKRKAFSKVLGHVGFHydrophilic
NLS Segment(s)
PositionSequence
102-112RGSTRRKKRKA
Subcellular Location(s) nucl 13, mito 12, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MGVTNSHLPIRSRKPSQTTSILLVSSSDPPSAHYSPKTTSTSPSNTKADPLQISPLSLSNNPTSASRLPTSFPIPTGDTQTPLRIGYPYYGEVVALQTKNHRGSTRRKKRKAFSKVLGHVGFGGSLQKEQIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.62
3 0.66
4 0.64
5 0.58
6 0.53
7 0.48
8 0.41
9 0.33
10 0.29
11 0.24
12 0.21
13 0.19
14 0.15
15 0.13
16 0.16
17 0.22
18 0.23
19 0.25
20 0.23
21 0.25
22 0.27
23 0.33
24 0.35
25 0.29
26 0.31
27 0.33
28 0.38
29 0.4
30 0.43
31 0.4
32 0.36
33 0.37
34 0.34
35 0.32
36 0.27
37 0.23
38 0.22
39 0.19
40 0.19
41 0.18
42 0.18
43 0.16
44 0.15
45 0.16
46 0.12
47 0.13
48 0.13
49 0.13
50 0.14
51 0.14
52 0.16
53 0.14
54 0.14
55 0.14
56 0.16
57 0.18
58 0.16
59 0.15
60 0.15
61 0.16
62 0.16
63 0.2
64 0.18
65 0.18
66 0.19
67 0.19
68 0.18
69 0.16
70 0.16
71 0.11
72 0.11
73 0.1
74 0.12
75 0.12
76 0.12
77 0.12
78 0.11
79 0.11
80 0.12
81 0.14
82 0.13
83 0.12
84 0.15
85 0.2
86 0.24
87 0.27
88 0.29
89 0.31
90 0.42
91 0.53
92 0.61
93 0.67
94 0.73
95 0.8
96 0.86
97 0.91
98 0.91
99 0.9
100 0.88
101 0.88
102 0.84
103 0.83
104 0.73
105 0.63
106 0.53
107 0.43
108 0.33
109 0.23
110 0.2
111 0.12
112 0.12