Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3DQG1

Protein Details
Accession A0A0C3DQG1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGSNRLTYRRRNPYNTRSNKVRIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MGSNRLTYRRRNPYNTRSNKVRIVKTPGGELRYLHIKKAGTAPKCGDCGIKLPGIPALRPREYSQISRPKKTVQRAYGGSRCANCVRDRIVRAFLIEEQKIVKKVLKESEQKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.83
4 0.8
5 0.77
6 0.77
7 0.75
8 0.71
9 0.67
10 0.66
11 0.64
12 0.57
13 0.58
14 0.53
15 0.47
16 0.42
17 0.36
18 0.3
19 0.34
20 0.34
21 0.27
22 0.27
23 0.24
24 0.25
25 0.33
26 0.37
27 0.29
28 0.32
29 0.35
30 0.34
31 0.35
32 0.34
33 0.26
34 0.2
35 0.21
36 0.19
37 0.17
38 0.14
39 0.13
40 0.16
41 0.15
42 0.15
43 0.17
44 0.2
45 0.2
46 0.22
47 0.24
48 0.27
49 0.29
50 0.32
51 0.35
52 0.41
53 0.45
54 0.46
55 0.47
56 0.48
57 0.53
58 0.58
59 0.58
60 0.52
61 0.55
62 0.56
63 0.61
64 0.58
65 0.54
66 0.48
67 0.4
68 0.39
69 0.35
70 0.34
71 0.28
72 0.28
73 0.3
74 0.33
75 0.36
76 0.36
77 0.37
78 0.34
79 0.34
80 0.32
81 0.31
82 0.31
83 0.28
84 0.25
85 0.24
86 0.27
87 0.28
88 0.28
89 0.27
90 0.25
91 0.32
92 0.39
93 0.45
94 0.51