Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WHL7

Protein Details
Accession Q4WHL7   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-25ETVDKIRRFAQKRQKAEEFYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020993  Centromere_CenpK  
Gene Ontology GO:0000775  C:chromosome, centromeric region  
GO:0005634  C:nucleus  
GO:0051382  P:kinetochore assembly  
GO:0000070  P:mitotic sister chromatid segregation  
KEGG afm:AFUA_2G04950  -  
Amino Acid Sequences MDISQETVDKIRRFAQKRQKAEEFYEEHSVNPANFDAYNRKLDETLAELQAQVKRHEDELRKLRMTTTIEFAQIGADPWARISEVRRAKKAYDSLLQSETRLPSPGSPLPSLLAVDEASRLVKESKTSISLTAEKLSADRQRLKAEEANLRDAQLIKDGLEKRIERLNAEKSSQVQKTPAQLAYDLVKEQQEKIERLDTTTEELKSSLYKFVEDTLAPMLAAENLGGPTVGDALEISDTTLKAGYTSHGKPKKPKTPAVGTSDSGQQRIDELVRRQTAQEGNEQATLLNKREAAAAEMRALLTALLDADYSYVDLPHESAASRFLVRAKVAQFHPRDARKLRLIDFGRSLVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.62
3 0.65
4 0.73
5 0.79
6 0.8
7 0.76
8 0.76
9 0.74
10 0.67
11 0.62
12 0.6
13 0.51
14 0.42
15 0.4
16 0.36
17 0.27
18 0.24
19 0.2
20 0.14
21 0.15
22 0.18
23 0.22
24 0.24
25 0.3
26 0.3
27 0.31
28 0.29
29 0.29
30 0.28
31 0.26
32 0.26
33 0.22
34 0.21
35 0.2
36 0.23
37 0.26
38 0.26
39 0.23
40 0.22
41 0.22
42 0.25
43 0.33
44 0.36
45 0.42
46 0.49
47 0.55
48 0.53
49 0.52
50 0.5
51 0.48
52 0.47
53 0.39
54 0.36
55 0.29
56 0.28
57 0.28
58 0.26
59 0.21
60 0.16
61 0.15
62 0.11
63 0.1
64 0.09
65 0.09
66 0.1
67 0.1
68 0.11
69 0.13
70 0.2
71 0.29
72 0.35
73 0.4
74 0.42
75 0.44
76 0.5
77 0.52
78 0.47
79 0.44
80 0.42
81 0.41
82 0.42
83 0.41
84 0.35
85 0.33
86 0.3
87 0.24
88 0.22
89 0.18
90 0.15
91 0.21
92 0.23
93 0.23
94 0.22
95 0.21
96 0.21
97 0.21
98 0.2
99 0.14
100 0.11
101 0.08
102 0.07
103 0.07
104 0.07
105 0.07
106 0.06
107 0.08
108 0.08
109 0.09
110 0.1
111 0.12
112 0.14
113 0.16
114 0.17
115 0.18
116 0.2
117 0.22
118 0.22
119 0.21
120 0.19
121 0.16
122 0.16
123 0.19
124 0.19
125 0.22
126 0.26
127 0.27
128 0.3
129 0.31
130 0.34
131 0.33
132 0.34
133 0.35
134 0.32
135 0.35
136 0.31
137 0.31
138 0.28
139 0.25
140 0.2
141 0.16
142 0.14
143 0.09
144 0.15
145 0.16
146 0.17
147 0.21
148 0.21
149 0.21
150 0.25
151 0.25
152 0.2
153 0.24
154 0.29
155 0.26
156 0.27
157 0.26
158 0.25
159 0.3
160 0.3
161 0.26
162 0.22
163 0.22
164 0.24
165 0.27
166 0.25
167 0.19
168 0.19
169 0.19
170 0.18
171 0.17
172 0.13
173 0.11
174 0.11
175 0.11
176 0.11
177 0.14
178 0.17
179 0.17
180 0.19
181 0.23
182 0.21
183 0.22
184 0.23
185 0.19
186 0.19
187 0.21
188 0.19
189 0.15
190 0.15
191 0.14
192 0.14
193 0.14
194 0.15
195 0.12
196 0.12
197 0.12
198 0.13
199 0.15
200 0.13
201 0.13
202 0.11
203 0.1
204 0.1
205 0.09
206 0.08
207 0.06
208 0.06
209 0.05
210 0.04
211 0.04
212 0.04
213 0.04
214 0.03
215 0.03
216 0.04
217 0.04
218 0.03
219 0.03
220 0.04
221 0.04
222 0.04
223 0.05
224 0.06
225 0.06
226 0.06
227 0.07
228 0.06
229 0.06
230 0.07
231 0.08
232 0.13
233 0.17
234 0.27
235 0.33
236 0.37
237 0.46
238 0.56
239 0.64
240 0.66
241 0.69
242 0.67
243 0.7
244 0.73
245 0.72
246 0.66
247 0.57
248 0.52
249 0.52
250 0.45
251 0.36
252 0.29
253 0.21
254 0.18
255 0.19
256 0.2
257 0.18
258 0.21
259 0.28
260 0.3
261 0.31
262 0.31
263 0.34
264 0.36
265 0.32
266 0.35
267 0.31
268 0.31
269 0.31
270 0.3
271 0.24
272 0.26
273 0.27
274 0.22
275 0.21
276 0.19
277 0.18
278 0.21
279 0.21
280 0.19
281 0.2
282 0.19
283 0.18
284 0.18
285 0.18
286 0.16
287 0.15
288 0.11
289 0.07
290 0.06
291 0.05
292 0.04
293 0.05
294 0.04
295 0.05
296 0.05
297 0.06
298 0.06
299 0.06
300 0.06
301 0.06
302 0.07
303 0.08
304 0.09
305 0.09
306 0.09
307 0.11
308 0.13
309 0.13
310 0.14
311 0.17
312 0.2
313 0.21
314 0.26
315 0.27
316 0.32
317 0.36
318 0.43
319 0.44
320 0.48
321 0.56
322 0.57
323 0.63
324 0.61
325 0.65
326 0.64
327 0.67
328 0.62
329 0.63
330 0.6
331 0.57
332 0.56