Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3CYM5

Protein Details
Accession A0A0C3CYM5    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
59-83AYRDCKKQWISERNEEKKKARKPLFHydrophilic
NLS Segment(s)
PositionSequence
75-80KKKARK
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MASPDAPEDTPWDPETRKKFESKRPGEFIDPCQEAAARSLKCLHRNSGAREMCADYFQAYRDCKKQWISERNEEKKKARKPLFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.37
3 0.4
4 0.41
5 0.47
6 0.53
7 0.6
8 0.69
9 0.69
10 0.7
11 0.69
12 0.68
13 0.65
14 0.6
15 0.54
16 0.5
17 0.43
18 0.34
19 0.29
20 0.26
21 0.21
22 0.2
23 0.22
24 0.14
25 0.14
26 0.2
27 0.22
28 0.28
29 0.3
30 0.3
31 0.31
32 0.36
33 0.4
34 0.45
35 0.42
36 0.37
37 0.37
38 0.36
39 0.29
40 0.25
41 0.21
42 0.12
43 0.12
44 0.13
45 0.16
46 0.16
47 0.2
48 0.24
49 0.26
50 0.3
51 0.35
52 0.41
53 0.47
54 0.55
55 0.59
56 0.65
57 0.74
58 0.79
59 0.83
60 0.81
61 0.8
62 0.8
63 0.81
64 0.81