Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3HJR9

Protein Details
Accession A0A0C3HJR9    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
154-179RTAIKEKKSLKCWKLKKRAHIKFLPTHydrophilic
NLS Segment(s)
PositionSequence
160-162KKS
167-171KLKKR
Subcellular Location(s) nucl 11, mito 10, cyto 5
Family & Domain DBs
Amino Acid Sequences MRIATPAEKRSIVRDLFGAEEKFRSFSTYFKTYDSLTAPQHTTVQIYPSAVNSHDDLRRLALELRADPQYTREEFRNRIFPPDVKDPETIIDQERAINIAVQLTFMIDCSDKDRHCEGYEVGGFRPVSWDNSEPFIDFVGKVFPADVHDHGKVRTAIKEKKSLKCWKLKKRAHIKFLPTDNLAEHLLYDPQDDVVRIFHQTAFLKAHLRLSAKMPLSCGLKDSLRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.29
4 0.33
5 0.3
6 0.23
7 0.25
8 0.24
9 0.24
10 0.23
11 0.24
12 0.19
13 0.21
14 0.27
15 0.3
16 0.3
17 0.3
18 0.32
19 0.29
20 0.32
21 0.32
22 0.29
23 0.27
24 0.29
25 0.28
26 0.28
27 0.28
28 0.25
29 0.24
30 0.2
31 0.19
32 0.17
33 0.17
34 0.16
35 0.15
36 0.16
37 0.15
38 0.16
39 0.15
40 0.18
41 0.19
42 0.2
43 0.19
44 0.19
45 0.19
46 0.18
47 0.19
48 0.17
49 0.17
50 0.17
51 0.19
52 0.19
53 0.19
54 0.18
55 0.18
56 0.21
57 0.2
58 0.22
59 0.24
60 0.28
61 0.32
62 0.35
63 0.41
64 0.37
65 0.4
66 0.41
67 0.38
68 0.38
69 0.43
70 0.43
71 0.38
72 0.38
73 0.33
74 0.31
75 0.3
76 0.25
77 0.18
78 0.16
79 0.13
80 0.12
81 0.12
82 0.11
83 0.1
84 0.09
85 0.07
86 0.07
87 0.06
88 0.06
89 0.06
90 0.05
91 0.05
92 0.05
93 0.05
94 0.04
95 0.05
96 0.08
97 0.12
98 0.12
99 0.16
100 0.17
101 0.19
102 0.19
103 0.2
104 0.17
105 0.18
106 0.2
107 0.18
108 0.16
109 0.18
110 0.17
111 0.15
112 0.17
113 0.13
114 0.13
115 0.15
116 0.16
117 0.14
118 0.17
119 0.17
120 0.15
121 0.15
122 0.13
123 0.11
124 0.1
125 0.09
126 0.08
127 0.07
128 0.07
129 0.07
130 0.06
131 0.09
132 0.11
133 0.13
134 0.16
135 0.17
136 0.19
137 0.19
138 0.23
139 0.23
140 0.22
141 0.26
142 0.3
143 0.35
144 0.39
145 0.49
146 0.52
147 0.57
148 0.64
149 0.69
150 0.68
151 0.71
152 0.77
153 0.78
154 0.82
155 0.82
156 0.83
157 0.84
158 0.86
159 0.85
160 0.82
161 0.79
162 0.76
163 0.74
164 0.69
165 0.59
166 0.51
167 0.42
168 0.37
169 0.3
170 0.22
171 0.17
172 0.13
173 0.13
174 0.12
175 0.12
176 0.1
177 0.1
178 0.11
179 0.11
180 0.1
181 0.11
182 0.12
183 0.13
184 0.14
185 0.13
186 0.18
187 0.19
188 0.22
189 0.24
190 0.25
191 0.27
192 0.27
193 0.31
194 0.3
195 0.32
196 0.3
197 0.31
198 0.37
199 0.37
200 0.37
201 0.34
202 0.35
203 0.36
204 0.34
205 0.32
206 0.28