Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q4WJ37

Protein Details
Accession Q4WJ37    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
164-184DEERKKVIRDHYRKKAIKYKTBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021475  DUF3128  
KEGG afm:AFUA_1G07360  -  
Pfam View protein in Pfam  
PF11326  DUF3128  
Amino Acid Sequences MGWLWRSSPSKEEPQQISSVPSFSDNAAPQPSPAAEAPGTMPSSSQSRPLSRKEQADAEFNQLLESLKADVSRTKSPQQSSNVSETPLSPSSPSPSGPPQPPSSIAPESLYPDSMSCRSAFDYAFFCQSFGGQFVNVYRYGELRSCSEHWDNFWLCMKARGMADEERKKVIRDHYRKKAIKYKTGPSSEDVWDLRREPVQHAFQGDFEALEREMKAEEEASRNAGGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.54
3 0.49
4 0.48
5 0.39
6 0.33
7 0.25
8 0.22
9 0.2
10 0.18
11 0.22
12 0.18
13 0.21
14 0.23
15 0.23
16 0.21
17 0.22
18 0.21
19 0.19
20 0.18
21 0.18
22 0.14
23 0.15
24 0.16
25 0.18
26 0.18
27 0.15
28 0.15
29 0.13
30 0.17
31 0.17
32 0.23
33 0.24
34 0.3
35 0.35
36 0.42
37 0.48
38 0.5
39 0.54
40 0.5
41 0.53
42 0.48
43 0.49
44 0.44
45 0.42
46 0.37
47 0.32
48 0.28
49 0.22
50 0.2
51 0.14
52 0.13
53 0.08
54 0.07
55 0.08
56 0.09
57 0.12
58 0.16
59 0.22
60 0.25
61 0.3
62 0.35
63 0.37
64 0.43
65 0.45
66 0.46
67 0.44
68 0.46
69 0.41
70 0.36
71 0.33
72 0.27
73 0.27
74 0.22
75 0.19
76 0.14
77 0.14
78 0.16
79 0.17
80 0.17
81 0.15
82 0.19
83 0.23
84 0.25
85 0.28
86 0.27
87 0.27
88 0.29
89 0.27
90 0.28
91 0.24
92 0.22
93 0.19
94 0.18
95 0.19
96 0.17
97 0.16
98 0.11
99 0.1
100 0.11
101 0.11
102 0.11
103 0.08
104 0.09
105 0.1
106 0.11
107 0.11
108 0.11
109 0.12
110 0.12
111 0.15
112 0.14
113 0.13
114 0.12
115 0.12
116 0.11
117 0.09
118 0.09
119 0.06
120 0.06
121 0.07
122 0.09
123 0.09
124 0.09
125 0.09
126 0.09
127 0.11
128 0.12
129 0.13
130 0.12
131 0.16
132 0.16
133 0.21
134 0.24
135 0.23
136 0.23
137 0.28
138 0.27
139 0.25
140 0.29
141 0.25
142 0.22
143 0.25
144 0.25
145 0.21
146 0.21
147 0.2
148 0.19
149 0.24
150 0.33
151 0.36
152 0.38
153 0.39
154 0.4
155 0.4
156 0.41
157 0.44
158 0.46
159 0.5
160 0.58
161 0.64
162 0.74
163 0.78
164 0.81
165 0.8
166 0.77
167 0.77
168 0.74
169 0.72
170 0.71
171 0.71
172 0.65
173 0.59
174 0.56
175 0.48
176 0.46
177 0.38
178 0.31
179 0.29
180 0.29
181 0.28
182 0.28
183 0.27
184 0.26
185 0.33
186 0.36
187 0.35
188 0.37
189 0.35
190 0.32
191 0.32
192 0.28
193 0.2
194 0.15
195 0.15
196 0.12
197 0.13
198 0.12
199 0.11
200 0.11
201 0.12
202 0.12
203 0.13
204 0.15
205 0.18
206 0.2
207 0.22