FuNGI

E9RCK4

Protein Details

Accession

E9RCK4

Localization Confidence

Medium

Confidence Score

13.3

NoLS Segment(s)

Position	Sequence	Protein Nature
225-245	GCRVRIRRDVRMRRRGEKRTD	Basic

NLS Segment(s)

Position	Sequence
238-238	R

Subcellular Location(s)

nucl 20.5, cyto_nucl 14, cyto 4.5

Family & Domain DBs

InterPro	View protein in InterPro IPR021740 Velvet IPR037525 Velvet_dom IPR038491 Velvet_dom_sf
Gene Ontology	GO:0005737 C:cytoplasm GO:0005634 C:nucleus GO:0043936 P:asexual sporulation resulting in formation of a cellular spore GO:0070787 P:conidiophore development GO:0070794 P:negative regulation of conidiophore development GO:0043942 P:negative regulation of sexual sporulation resulting in formation of a cellular spore GO:0043945 P:positive regulation of asexual sporulation resulting in formation of a cellular spore GO:1900691 P:positive regulation of gliotoxin biosynthetic process GO:0009847 P:spore germination
KEGG	afm:AFUA_1G12490 -
Pfam	View protein in Pfam PF11754 Velvet
PROSITE	View protein in PROSITE PS51821 VELVET

Amino Acid Sequences

MATRPPLMPPANETESSVSRISREGKKITYKLSVMQQPERARACGAGAKSSADRRPVDPPPVVELRIFESDPNDDLHKTDITFAYNANFFLFATLETARPMAQGRLTGPPTCPVLTGVPVAGVAYLDRPQQAGYFIFPDLSVRHEGRYRLSFHLYEEIKDIKDADKDTPMPDLNSSTNLTKPSAPKAHLNFRLEVKSVPFTVYSAKKFPGLATSTSLSRIIAEQGCRVRIRRDVRMRRRGEKRTDDYDFDDERAFATRSDRYTTPDMYAANSAERARSTSISTTADTSFPYGSDAQRRPSAGDYGFQGAQPYQRSMPAASAAPAPAPVHSPATSAQTSSYQSHLSFGATQSQYPAPQLPPTPQSATPTNTYSPHPSYSHSRNPSNGTEYDATSSGYPYPQPRLPADRPSYSKAALPPLRLEPPKAPNMQTSTDSRSSDANAYPTLSQPPVPRAPTPANHVTSLPPLKVLSGEYSHPSQPNAQSPHHDLGSGKRLLWETNHTLSKRSHEETFGSDERPLHNGMRPDMDQYPSMGRKQPDYGRLPFYTDSRDEMAYKRANGRMVMKILPALP

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.35
2	0.35
3	0.37
4	0.34
5	0.26
6	0.23
7	0.27
8	0.32
9	0.36
10	0.41
11	0.43
12	0.49
13	0.58
14	0.62
15	0.62
16	0.63
17	0.56
18	0.54
19	0.57
20	0.56
21	0.53
22	0.55
23	0.57
24	0.54
25	0.6
26	0.57
27	0.5
28	0.44
29	0.38
30	0.35
31	0.33
32	0.29
33	0.26
34	0.24
35	0.25
36	0.29
37	0.34
38	0.35
39	0.37
40	0.38
41	0.37
42	0.43
43	0.47
44	0.49
45	0.46
46	0.44
47	0.44
48	0.45
49	0.44
50	0.37
51	0.32
52	0.29
53	0.29
54	0.27
55	0.22
56	0.2
57	0.21
58	0.22
59	0.22
60	0.2
61	0.17
62	0.17
63	0.2
64	0.19
65	0.17
66	0.2
67	0.19
68	0.19
69	0.19
70	0.19
71	0.19
72	0.19
73	0.19
74	0.16
75	0.14
76	0.11
77	0.12
78	0.11
79	0.08
80	0.1
81	0.11
82	0.1
83	0.11
84	0.12
85	0.11
86	0.12
87	0.13
88	0.12
89	0.13
90	0.14
91	0.16
92	0.23
93	0.26
94	0.26
95	0.26
96	0.27
97	0.29
98	0.27
99	0.25
100	0.2
101	0.19
102	0.19
103	0.18
104	0.15
105	0.12
106	0.11
107	0.11
108	0.08
109	0.07
110	0.05
111	0.06
112	0.07
113	0.09
114	0.09
115	0.1
116	0.1
117	0.11
118	0.13
119	0.12
120	0.12
121	0.13
122	0.13
123	0.12
124	0.12
125	0.13
126	0.11
127	0.13
128	0.16
129	0.15
130	0.18
131	0.21
132	0.23
133	0.27
134	0.31
135	0.32
136	0.31
137	0.35
138	0.33
139	0.31
140	0.38
141	0.33
142	0.29
143	0.29
144	0.27
145	0.23
146	0.23
147	0.22
148	0.16
149	0.18
150	0.19
151	0.18
152	0.21
153	0.22
154	0.22
155	0.25
156	0.24
157	0.21
158	0.21
159	0.21
160	0.17
161	0.19
162	0.2
163	0.17
164	0.18
165	0.19
166	0.2
167	0.21
168	0.22
169	0.28
170	0.31
171	0.32
172	0.37
173	0.41
174	0.49
175	0.53
176	0.53
177	0.48
178	0.46
179	0.47
180	0.4
181	0.35
182	0.28
183	0.23
184	0.21
185	0.19
186	0.16
187	0.14
188	0.19
189	0.22
190	0.23
191	0.23
192	0.23
193	0.24
194	0.24
195	0.24
196	0.24
197	0.21
198	0.2
199	0.2
200	0.21
201	0.2
202	0.21
203	0.21
204	0.15
205	0.12
206	0.12
207	0.12
208	0.13
209	0.13
210	0.16
211	0.18
212	0.21
213	0.22
214	0.23
215	0.22
216	0.28
217	0.32
218	0.38
219	0.47
220	0.55
221	0.64
222	0.73
223	0.76
224	0.78
225	0.82
226	0.81
227	0.79
228	0.77
229	0.73
230	0.7
231	0.67
232	0.6
233	0.54
234	0.51
235	0.43
236	0.34
237	0.28
238	0.21
239	0.18
240	0.18
241	0.15
242	0.1
243	0.12
244	0.13
245	0.15
246	0.18
247	0.19
248	0.2
249	0.23
250	0.24
251	0.22
252	0.22
253	0.2
254	0.18
255	0.18
256	0.14
257	0.12
258	0.12
259	0.11
260	0.1
261	0.09
262	0.1
263	0.1
264	0.1
265	0.11
266	0.11
267	0.13
268	0.14
269	0.14
270	0.15
271	0.14
272	0.14
273	0.13
274	0.13
275	0.1
276	0.08
277	0.1
278	0.09
279	0.1
280	0.17
281	0.19
282	0.21
283	0.23
284	0.23
285	0.23
286	0.23
287	0.25
288	0.17
289	0.17
290	0.16
291	0.16
292	0.16
293	0.15
294	0.14
295	0.11
296	0.13
297	0.13
298	0.14
299	0.12
300	0.12
301	0.13
302	0.13
303	0.13
304	0.12
305	0.11
306	0.1
307	0.1
308	0.09
309	0.08
310	0.09
311	0.08
312	0.07
313	0.08
314	0.09
315	0.1
316	0.1
317	0.12
318	0.12
319	0.16
320	0.16
321	0.14
322	0.14
323	0.14
324	0.17
325	0.17
326	0.18
327	0.15
328	0.15
329	0.16
330	0.15
331	0.14
332	0.12
333	0.11
334	0.17
335	0.16
336	0.16
337	0.17
338	0.18
339	0.17
340	0.17
341	0.19
342	0.13
343	0.15
344	0.16
345	0.17
346	0.19
347	0.22
348	0.24
349	0.23
350	0.26
351	0.27
352	0.28
353	0.28
354	0.28
355	0.27
356	0.26
357	0.27
358	0.28
359	0.27
360	0.28
361	0.27
362	0.27
363	0.32
364	0.38
365	0.45
366	0.45
367	0.46
368	0.45
369	0.49
370	0.49
371	0.46
372	0.4
373	0.35
374	0.3
375	0.28
376	0.27
377	0.22
378	0.19
379	0.15
380	0.15
381	0.11
382	0.11
383	0.12
384	0.13
385	0.18
386	0.2
387	0.23
388	0.25
389	0.33
390	0.36
391	0.43
392	0.46
393	0.48
394	0.5
395	0.51
396	0.5
397	0.43
398	0.42
399	0.35
400	0.39
401	0.36
402	0.34
403	0.32
404	0.33
405	0.4
406	0.38
407	0.39
408	0.35
409	0.38
410	0.43
411	0.43
412	0.41
413	0.39
414	0.42
415	0.42
416	0.38
417	0.37
418	0.37
419	0.38
420	0.37
421	0.33
422	0.3
423	0.29
424	0.3
425	0.27
426	0.23
427	0.19
428	0.2
429	0.19
430	0.2
431	0.21
432	0.18
433	0.2
434	0.2
435	0.26
436	0.3
437	0.33
438	0.32
439	0.35
440	0.4
441	0.4
442	0.45
443	0.46
444	0.43
445	0.41
446	0.41
447	0.36
448	0.39
449	0.38
450	0.31
451	0.25
452	0.22
453	0.21
454	0.21
455	0.21
456	0.16
457	0.15
458	0.17
459	0.19
460	0.22
461	0.26
462	0.26
463	0.26
464	0.28
465	0.3
466	0.37
467	0.39
468	0.38
469	0.41
470	0.45
471	0.49
472	0.43
473	0.4
474	0.32
475	0.34
476	0.39
477	0.35
478	0.29
479	0.28
480	0.29
481	0.29
482	0.32
483	0.32
484	0.3
485	0.36
486	0.43
487	0.4
488	0.43
489	0.44
490	0.48
491	0.48
492	0.46
493	0.42
494	0.38
495	0.4
496	0.4
497	0.45
498	0.4
499	0.35
500	0.33
501	0.32
502	0.31
503	0.31
504	0.3
505	0.25
506	0.26
507	0.29
508	0.3
509	0.34
510	0.32
511	0.35
512	0.35
513	0.35
514	0.31
515	0.29
516	0.34
517	0.32
518	0.35
519	0.37
520	0.36
521	0.38
522	0.45
523	0.5
524	0.51
525	0.53
526	0.55
527	0.56
528	0.55
529	0.55
530	0.5
531	0.46
532	0.43
533	0.38
534	0.37
535	0.33
536	0.34
537	0.31
538	0.31
539	0.37
540	0.35
541	0.38
542	0.41
543	0.42
544	0.43
545	0.45
546	0.48
547	0.47
548	0.45
549	0.43
550	0.38

E9RCK4

3D AlphaFold-predicted Structure Viewer