Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3HME0

Protein Details
Accession A0A0C3HME0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
39-58VTQRSQPQPRPQPQRLRSPLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, plas 10, mito 3, E.R. 2
Family & Domain DBs
Amino Acid Sequences MMMVSSLSRAAAAVRVLSILYILFSCFCFLDVAVASPDVTQRSQPQPRPQPQRLRSPLPSRPRAQLQQAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.07
6 0.05
7 0.05
8 0.04
9 0.05
10 0.05
11 0.05
12 0.06
13 0.06
14 0.07
15 0.06
16 0.06
17 0.07
18 0.07
19 0.08
20 0.07
21 0.07
22 0.06
23 0.06
24 0.07
25 0.07
26 0.08
27 0.08
28 0.12
29 0.21
30 0.28
31 0.35
32 0.44
33 0.53
34 0.62
35 0.71
36 0.75
37 0.77
38 0.76
39 0.81
40 0.78
41 0.76
42 0.75
43 0.74
44 0.74
45 0.73
46 0.76
47 0.69
48 0.69
49 0.69
50 0.68