Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3HDW6

Protein Details
Accession A0A0C3HDW6    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
209-236VGPQLTKRIKRKRGSIHRYKPKNIHCKKBasic
NLS Segment(s)
PositionSequence
88-93RGRKRA
215-249KRIKRKRGSIHRYKPKNIHCKKVISKDIKAKAREE
Subcellular Location(s) mito 15, nucl 11, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MAPIRTRRSCARHFMPPCELTCSDGQIKTLQRCAILTARLLAQELNIQIPQPLLYSLTGVPPCNQSRILASKQVRTLHNQVDKGPDPRGRKRALKRSDTAAIADYLDDSNTLLDKKGAPWHDIAEQAGIKLPCTTHFKPLGLRLVNTQSIQRACKEDKGIINAICEEEKELTDAQATVCLDWIDIQLTIRPHSNHWKDVAFCNEFHFGVGPQLTKRIKRKRGSIHRYKPKNIHCKKVISKDIKAKAREEKHLKLVNIFVIIGWDYRKIIPYKVPNKVGKMTSKVYTEEILPSILQDLKDQGLTLCQDADLAHDSKETKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.69
3 0.65
4 0.6
5 0.57
6 0.51
7 0.44
8 0.4
9 0.38
10 0.35
11 0.32
12 0.31
13 0.3
14 0.36
15 0.37
16 0.41
17 0.37
18 0.33
19 0.32
20 0.35
21 0.34
22 0.29
23 0.26
24 0.23
25 0.22
26 0.22
27 0.22
28 0.17
29 0.13
30 0.15
31 0.14
32 0.14
33 0.13
34 0.13
35 0.13
36 0.13
37 0.13
38 0.1
39 0.09
40 0.09
41 0.09
42 0.11
43 0.11
44 0.16
45 0.18
46 0.18
47 0.19
48 0.24
49 0.26
50 0.27
51 0.27
52 0.22
53 0.26
54 0.31
55 0.33
56 0.35
57 0.37
58 0.39
59 0.44
60 0.49
61 0.45
62 0.45
63 0.48
64 0.48
65 0.52
66 0.48
67 0.44
68 0.46
69 0.47
70 0.44
71 0.43
72 0.41
73 0.41
74 0.48
75 0.54
76 0.53
77 0.59
78 0.66
79 0.71
80 0.74
81 0.74
82 0.69
83 0.68
84 0.66
85 0.58
86 0.49
87 0.4
88 0.31
89 0.23
90 0.2
91 0.14
92 0.09
93 0.08
94 0.07
95 0.06
96 0.05
97 0.06
98 0.06
99 0.06
100 0.07
101 0.07
102 0.09
103 0.15
104 0.17
105 0.18
106 0.18
107 0.2
108 0.21
109 0.21
110 0.2
111 0.16
112 0.14
113 0.13
114 0.15
115 0.13
116 0.12
117 0.11
118 0.11
119 0.12
120 0.2
121 0.22
122 0.24
123 0.27
124 0.28
125 0.3
126 0.34
127 0.38
128 0.31
129 0.3
130 0.26
131 0.27
132 0.27
133 0.25
134 0.22
135 0.18
136 0.19
137 0.2
138 0.19
139 0.2
140 0.19
141 0.22
142 0.23
143 0.24
144 0.23
145 0.26
146 0.28
147 0.24
148 0.23
149 0.2
150 0.18
151 0.14
152 0.12
153 0.1
154 0.07
155 0.07
156 0.07
157 0.07
158 0.07
159 0.07
160 0.07
161 0.06
162 0.08
163 0.08
164 0.07
165 0.07
166 0.07
167 0.07
168 0.07
169 0.07
170 0.05
171 0.05
172 0.06
173 0.08
174 0.09
175 0.1
176 0.12
177 0.13
178 0.15
179 0.25
180 0.29
181 0.29
182 0.31
183 0.32
184 0.31
185 0.34
186 0.38
187 0.3
188 0.26
189 0.27
190 0.26
191 0.24
192 0.22
193 0.19
194 0.12
195 0.13
196 0.14
197 0.12
198 0.1
199 0.18
200 0.21
201 0.27
202 0.37
203 0.45
204 0.53
205 0.58
206 0.68
207 0.72
208 0.8
209 0.84
210 0.85
211 0.86
212 0.87
213 0.89
214 0.87
215 0.85
216 0.84
217 0.84
218 0.8
219 0.79
220 0.74
221 0.75
222 0.76
223 0.76
224 0.76
225 0.72
226 0.73
227 0.73
228 0.76
229 0.74
230 0.68
231 0.64
232 0.64
233 0.63
234 0.65
235 0.64
236 0.6
237 0.62
238 0.65
239 0.61
240 0.53
241 0.5
242 0.42
243 0.35
244 0.29
245 0.19
246 0.14
247 0.14
248 0.13
249 0.11
250 0.1
251 0.11
252 0.12
253 0.17
254 0.18
255 0.2
256 0.28
257 0.37
258 0.45
259 0.52
260 0.6
261 0.61
262 0.64
263 0.68
264 0.65
265 0.62
266 0.59
267 0.54
268 0.5
269 0.48
270 0.44
271 0.4
272 0.36
273 0.31
274 0.27
275 0.24
276 0.2
277 0.17
278 0.15
279 0.15
280 0.17
281 0.15
282 0.14
283 0.15
284 0.16
285 0.16
286 0.16
287 0.14
288 0.16
289 0.17
290 0.17
291 0.15
292 0.13
293 0.13
294 0.13
295 0.16
296 0.16
297 0.16
298 0.15
299 0.18