Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3HU42

Protein Details
Accession A0A0C3HU42    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MGRHTGCDTCRKRKIKCDRLEPACVNHydrophilic
52-76ASGRSKSKSSSPKSKRRSDEVVKETHydrophilic
NLS Segment(s)
PositionSequence
58-67SKSSSPKSKR
Subcellular Location(s) mito 16, nucl 9, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MGRHTGCDTCRKRKIKCDRLEPACVNCVRSGWQCPGYPPKFEFHEVTISSAASGRSKSKSSSPKSKRRSDEVVKET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.82
4 0.82
5 0.82
6 0.8
7 0.82
8 0.75
9 0.66
10 0.62
11 0.53
12 0.44
13 0.34
14 0.29
15 0.23
16 0.22
17 0.23
18 0.21
19 0.24
20 0.22
21 0.25
22 0.34
23 0.33
24 0.33
25 0.3
26 0.29
27 0.28
28 0.31
29 0.29
30 0.21
31 0.25
32 0.23
33 0.23
34 0.21
35 0.18
36 0.15
37 0.15
38 0.14
39 0.1
40 0.11
41 0.13
42 0.16
43 0.18
44 0.2
45 0.28
46 0.37
47 0.44
48 0.54
49 0.61
50 0.68
51 0.76
52 0.83
53 0.82
54 0.8
55 0.81
56 0.8