Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3HH07

Protein Details
Accession A0A0C3HH07    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
127-146APTHSETEKAKPKKRVHWASHydrophilic
NLS Segment(s)
PositionSequence
138-140PKK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
Amino Acid Sequences RSVLPLEDDDDDDDDDEFVLAMPFTLKDFTSDGRESRAAQRPDGLTGLGISLPQQLRSSRGRPTVRLTPPSRNGKGRGQTRSLSARRPHSWRVPSPELGSIMEEKECEEEGKREVEVKKKVELSMSAPTHSETEKAKPKKRVHWAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.09
4 0.07
5 0.06
6 0.05
7 0.05
8 0.04
9 0.05
10 0.05
11 0.06
12 0.07
13 0.07
14 0.09
15 0.11
16 0.13
17 0.19
18 0.21
19 0.21
20 0.24
21 0.25
22 0.26
23 0.32
24 0.39
25 0.35
26 0.33
27 0.37
28 0.33
29 0.34
30 0.32
31 0.24
32 0.15
33 0.13
34 0.13
35 0.08
36 0.07
37 0.05
38 0.09
39 0.09
40 0.1
41 0.12
42 0.12
43 0.16
44 0.21
45 0.24
46 0.24
47 0.33
48 0.34
49 0.35
50 0.4
51 0.46
52 0.45
53 0.51
54 0.49
55 0.48
56 0.53
57 0.59
58 0.57
59 0.51
60 0.5
61 0.48
62 0.53
63 0.52
64 0.48
65 0.44
66 0.41
67 0.42
68 0.47
69 0.43
70 0.42
71 0.4
72 0.43
73 0.44
74 0.49
75 0.5
76 0.5
77 0.55
78 0.53
79 0.57
80 0.55
81 0.52
82 0.49
83 0.46
84 0.39
85 0.32
86 0.28
87 0.21
88 0.17
89 0.14
90 0.12
91 0.1
92 0.1
93 0.1
94 0.1
95 0.11
96 0.12
97 0.14
98 0.16
99 0.15
100 0.2
101 0.23
102 0.31
103 0.36
104 0.37
105 0.41
106 0.42
107 0.43
108 0.4
109 0.39
110 0.35
111 0.37
112 0.36
113 0.31
114 0.28
115 0.29
116 0.28
117 0.26
118 0.25
119 0.18
120 0.26
121 0.35
122 0.44
123 0.52
124 0.6
125 0.68
126 0.75