Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3HLH6

Protein Details
Accession A0A0C3HLH6    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSKRSRSRMNLRVRHNKVASHydrophilic
23-47PLDKLSHKIGKKRRLRARFEKMGANBasic
NLS Segment(s)
PositionSequence
5-41SRSRMNLRVRHNKVASKAPLDKLSHKIGKKRRLRARF
Subcellular Location(s) nucl 22, mito_nucl 13.5, mito 3
Family & Domain DBs
Amino Acid Sequences MSKRSRSRMNLRVRHNKVASKAPLDKLSHKIGKKRRLRARFEKMGANQIADIIAAKRCKSTKIDNYEVEDFIVVDVGTEAVDEPVEELVEASVEEPVDEPICWKENLDMGRSTNKKNPPWIWNPDSNYDSGVLDNSSQAISETSLAESTQSRTLGIKLRHSSPDSGLYLTENPCGNFSSSMPCVNDIPRYRGLNLGNIFLSHVQLICAVAHRISSDGIQRNQRPFHKQQFFYLEWWRFAGKTKRALSSLALCHFSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.8
3 0.76
4 0.7
5 0.71
6 0.67
7 0.64
8 0.63
9 0.58
10 0.59
11 0.57
12 0.57
13 0.53
14 0.56
15 0.56
16 0.55
17 0.59
18 0.62
19 0.68
20 0.72
21 0.77
22 0.78
23 0.81
24 0.85
25 0.87
26 0.88
27 0.87
28 0.81
29 0.79
30 0.71
31 0.7
32 0.61
33 0.51
34 0.41
35 0.31
36 0.27
37 0.18
38 0.16
39 0.09
40 0.12
41 0.13
42 0.13
43 0.17
44 0.18
45 0.22
46 0.27
47 0.35
48 0.41
49 0.47
50 0.54
51 0.53
52 0.58
53 0.57
54 0.52
55 0.42
56 0.33
57 0.24
58 0.17
59 0.14
60 0.07
61 0.04
62 0.04
63 0.04
64 0.04
65 0.03
66 0.04
67 0.03
68 0.03
69 0.03
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.03
76 0.04
77 0.04
78 0.03
79 0.04
80 0.04
81 0.04
82 0.04
83 0.05
84 0.06
85 0.05
86 0.06
87 0.08
88 0.1
89 0.1
90 0.1
91 0.1
92 0.13
93 0.15
94 0.16
95 0.16
96 0.16
97 0.24
98 0.26
99 0.28
100 0.31
101 0.36
102 0.37
103 0.42
104 0.46
105 0.45
106 0.49
107 0.54
108 0.52
109 0.51
110 0.5
111 0.47
112 0.44
113 0.37
114 0.3
115 0.23
116 0.19
117 0.13
118 0.11
119 0.07
120 0.06
121 0.06
122 0.06
123 0.05
124 0.04
125 0.05
126 0.05
127 0.05
128 0.05
129 0.06
130 0.06
131 0.06
132 0.06
133 0.07
134 0.07
135 0.09
136 0.1
137 0.1
138 0.1
139 0.11
140 0.13
141 0.19
142 0.21
143 0.26
144 0.27
145 0.3
146 0.34
147 0.35
148 0.35
149 0.3
150 0.33
151 0.27
152 0.25
153 0.21
154 0.19
155 0.2
156 0.19
157 0.2
158 0.15
159 0.14
160 0.15
161 0.16
162 0.15
163 0.13
164 0.13
165 0.16
166 0.16
167 0.19
168 0.19
169 0.19
170 0.2
171 0.2
172 0.27
173 0.25
174 0.28
175 0.31
176 0.33
177 0.32
178 0.36
179 0.35
180 0.35
181 0.33
182 0.31
183 0.25
184 0.23
185 0.23
186 0.18
187 0.18
188 0.11
189 0.09
190 0.07
191 0.08
192 0.08
193 0.08
194 0.09
195 0.09
196 0.09
197 0.09
198 0.1
199 0.1
200 0.1
201 0.12
202 0.18
203 0.24
204 0.29
205 0.38
206 0.43
207 0.49
208 0.56
209 0.6
210 0.61
211 0.63
212 0.69
213 0.7
214 0.66
215 0.67
216 0.68
217 0.64
218 0.6
219 0.61
220 0.54
221 0.46
222 0.45
223 0.39
224 0.32
225 0.38
226 0.43
227 0.4
228 0.46
229 0.49
230 0.53
231 0.53
232 0.55
233 0.51
234 0.49
235 0.49
236 0.45