Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WJL1

Protein Details
Accession Q4WJL1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MINNGARTTRPKRRWKHVKVDCGMAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18, cyto_nucl 9.833, cyto_pero 9.833, mito 8
Family & Domain DBs
KEGG afm:AFUA_1G05600  -  
Amino Acid Sequences MINNGARTTRPKRRWKHVKVDCGMAVKIDTTDGDVGLDAEIYQAGDINTWNGSCEIATWPSALVRWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.89
4 0.87
5 0.88
6 0.8
7 0.77
8 0.68
9 0.6
10 0.5
11 0.39
12 0.3
13 0.2
14 0.17
15 0.11
16 0.08
17 0.06
18 0.06
19 0.05
20 0.05
21 0.05
22 0.05
23 0.04
24 0.04
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.04
33 0.04
34 0.05
35 0.06
36 0.06
37 0.07
38 0.07
39 0.07
40 0.07
41 0.08
42 0.1
43 0.11
44 0.12
45 0.11
46 0.12
47 0.12