Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3GZU8

Protein Details
Accession A0A0C3GZU8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
48-69LTCGGGGHTRRRYRRRHVASRVBasic
NLS Segment(s)
Subcellular Location(s) plas 15, vacu 5, mito 3, pero 2, cyto_mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGAVVSCIEAVFRTIGACLMAIVNGIASVLQAIIGAIAGVFDIIISCLTCGGGGHTRRRYRRRHVASRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.07
4 0.07
5 0.06
6 0.05
7 0.05
8 0.05
9 0.04
10 0.04
11 0.03
12 0.03
13 0.03
14 0.02
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.01
28 0.01
29 0.02
30 0.02
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.04
37 0.04
38 0.07
39 0.14
40 0.19
41 0.28
42 0.37
43 0.45
44 0.55
45 0.64
46 0.71
47 0.74
48 0.81
49 0.83