Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3CUT7

Protein Details
Accession A0A0C3CUT7   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
58-83SEPGTSKRREQVRKAQRTHRQRTQAYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MDHPEDKLAPKEYSFVLQEGTGGEQPGPLTLLRRSKRVLGDVDLGEASIPTYSESSTSEPGTSKRREQVRKAQRTHRQRTQAYIKELENEVLRLRRSESEALSKAAKFQQDVNSLLSILAQHSIVPPPGIGDGQSYSPEPAGHVELRSLENPTVASVDLSIPDASGSSSSFNLRVLDTFSGSESESPVRSGVEGRSQTPVSGAATSQNRQPSLLQDPRVGIDFVLTLERPCLLHLRQSHLDYNDRAETPSEHSRLASGHLFTASLQMWQPSLRDRSNPESYAVSTAELERLLTTSLNIGIKDDELTPVQIWNILGSFAIPGDQQREVLEKLTEELSKHVECLHFGAIIKLERVDRIFREYLPEGTLTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.25
3 0.21
4 0.19
5 0.19
6 0.17
7 0.19
8 0.16
9 0.14
10 0.13
11 0.13
12 0.13
13 0.13
14 0.13
15 0.1
16 0.12
17 0.18
18 0.28
19 0.29
20 0.35
21 0.37
22 0.43
23 0.47
24 0.5
25 0.48
26 0.43
27 0.47
28 0.42
29 0.41
30 0.34
31 0.29
32 0.22
33 0.18
34 0.13
35 0.07
36 0.06
37 0.05
38 0.06
39 0.07
40 0.08
41 0.1
42 0.14
43 0.16
44 0.17
45 0.18
46 0.19
47 0.24
48 0.31
49 0.33
50 0.36
51 0.41
52 0.5
53 0.57
54 0.64
55 0.7
56 0.73
57 0.79
58 0.81
59 0.84
60 0.84
61 0.86
62 0.87
63 0.86
64 0.84
65 0.76
66 0.77
67 0.78
68 0.75
69 0.7
70 0.65
71 0.56
72 0.51
73 0.49
74 0.42
75 0.32
76 0.26
77 0.23
78 0.22
79 0.22
80 0.18
81 0.2
82 0.21
83 0.24
84 0.27
85 0.27
86 0.31
87 0.32
88 0.33
89 0.33
90 0.31
91 0.3
92 0.29
93 0.28
94 0.21
95 0.24
96 0.29
97 0.3
98 0.32
99 0.3
100 0.27
101 0.26
102 0.25
103 0.2
104 0.13
105 0.09
106 0.08
107 0.06
108 0.06
109 0.07
110 0.08
111 0.08
112 0.08
113 0.07
114 0.07
115 0.08
116 0.08
117 0.07
118 0.07
119 0.08
120 0.08
121 0.1
122 0.09
123 0.09
124 0.1
125 0.09
126 0.09
127 0.09
128 0.11
129 0.11
130 0.11
131 0.11
132 0.12
133 0.14
134 0.14
135 0.14
136 0.12
137 0.11
138 0.11
139 0.11
140 0.1
141 0.08
142 0.07
143 0.06
144 0.06
145 0.06
146 0.07
147 0.06
148 0.06
149 0.05
150 0.06
151 0.05
152 0.05
153 0.05
154 0.05
155 0.06
156 0.07
157 0.07
158 0.08
159 0.09
160 0.09
161 0.08
162 0.1
163 0.09
164 0.09
165 0.09
166 0.09
167 0.09
168 0.09
169 0.09
170 0.08
171 0.08
172 0.08
173 0.08
174 0.08
175 0.07
176 0.07
177 0.08
178 0.08
179 0.14
180 0.15
181 0.15
182 0.18
183 0.18
184 0.18
185 0.17
186 0.17
187 0.11
188 0.1
189 0.09
190 0.11
191 0.14
192 0.15
193 0.18
194 0.2
195 0.19
196 0.19
197 0.2
198 0.19
199 0.25
200 0.29
201 0.28
202 0.26
203 0.27
204 0.27
205 0.27
206 0.24
207 0.15
208 0.1
209 0.08
210 0.07
211 0.08
212 0.07
213 0.06
214 0.06
215 0.07
216 0.07
217 0.07
218 0.11
219 0.1
220 0.16
221 0.18
222 0.25
223 0.29
224 0.32
225 0.35
226 0.34
227 0.37
228 0.32
229 0.34
230 0.3
231 0.26
232 0.24
233 0.21
234 0.2
235 0.22
236 0.28
237 0.26
238 0.23
239 0.23
240 0.23
241 0.22
242 0.24
243 0.21
244 0.14
245 0.14
246 0.13
247 0.13
248 0.13
249 0.15
250 0.12
251 0.11
252 0.1
253 0.1
254 0.11
255 0.11
256 0.12
257 0.15
258 0.2
259 0.21
260 0.25
261 0.3
262 0.37
263 0.42
264 0.43
265 0.39
266 0.36
267 0.35
268 0.34
269 0.29
270 0.22
271 0.16
272 0.16
273 0.15
274 0.12
275 0.12
276 0.09
277 0.09
278 0.09
279 0.08
280 0.08
281 0.08
282 0.11
283 0.13
284 0.12
285 0.13
286 0.13
287 0.13
288 0.14
289 0.13
290 0.12
291 0.11
292 0.13
293 0.13
294 0.13
295 0.12
296 0.13
297 0.12
298 0.11
299 0.11
300 0.09
301 0.08
302 0.08
303 0.08
304 0.06
305 0.07
306 0.06
307 0.08
308 0.11
309 0.12
310 0.12
311 0.13
312 0.17
313 0.18
314 0.2
315 0.19
316 0.16
317 0.18
318 0.2
319 0.21
320 0.18
321 0.2
322 0.23
323 0.22
324 0.22
325 0.24
326 0.22
327 0.21
328 0.23
329 0.22
330 0.19
331 0.19
332 0.21
333 0.21
334 0.22
335 0.22
336 0.21
337 0.21
338 0.22
339 0.25
340 0.28
341 0.26
342 0.32
343 0.33
344 0.31
345 0.37
346 0.37
347 0.36
348 0.33