Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3HF04

Protein Details
Accession A0A0C3HF04    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
54-76VTNKVYKKPKSGRGKTDEKKKLNBasic
NLS Segment(s)
PositionSequence
60-74KKPKSGRGKTDEKKK
Subcellular Location(s) cyto 6.5, extr 6, cyto_nucl 5.5, plas 5, E.R. 4, nucl 3.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGQAFSGPNAFNWLNLTPEATAVLRANPFLFAELVIVLVSCMLIILLAWYIHFVTNKVYKKPKSGRGKTDEKKKLNIPHVAPWVAKVGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.19
4 0.13
5 0.13
6 0.14
7 0.11
8 0.12
9 0.11
10 0.13
11 0.12
12 0.12
13 0.12
14 0.11
15 0.11
16 0.1
17 0.09
18 0.07
19 0.07
20 0.06
21 0.06
22 0.05
23 0.05
24 0.03
25 0.03
26 0.03
27 0.02
28 0.02
29 0.02
30 0.02
31 0.01
32 0.02
33 0.02
34 0.02
35 0.03
36 0.03
37 0.04
38 0.05
39 0.06
40 0.06
41 0.1
42 0.18
43 0.21
44 0.27
45 0.35
46 0.37
47 0.46
48 0.54
49 0.6
50 0.64
51 0.69
52 0.73
53 0.73
54 0.81
55 0.8
56 0.83
57 0.83
58 0.77
59 0.75
60 0.73
61 0.74
62 0.71
63 0.71
64 0.63
65 0.62
66 0.64
67 0.61
68 0.53
69 0.45