Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3H360

Protein Details
Accession A0A0C3H360    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
39-64AQNRASQRAFRKRKEKRMKDIEEQLTHydrophilic
NLS Segment(s)
PositionSequence
23-56EGNKRAIPHHILLRRRAQNRASQRAFRKRKEKRM
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences GMIPVQSDIQEIDKTEEWKMGKEGNKRAIPHHILLRRRAQNRASQRAFRKRKEKRMKDIEEQLTDLQERHSELIQMYKTLQLECSATRQEMETLRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.25
4 0.23
5 0.24
6 0.25
7 0.27
8 0.3
9 0.36
10 0.43
11 0.47
12 0.51
13 0.5
14 0.51
15 0.53
16 0.5
17 0.46
18 0.46
19 0.44
20 0.43
21 0.47
22 0.53
23 0.52
24 0.52
25 0.54
26 0.48
27 0.51
28 0.56
29 0.6
30 0.55
31 0.54
32 0.6
33 0.65
34 0.7
35 0.69
36 0.7
37 0.7
38 0.77
39 0.81
40 0.82
41 0.81
42 0.84
43 0.84
44 0.8
45 0.81
46 0.75
47 0.65
48 0.58
49 0.48
50 0.39
51 0.32
52 0.25
53 0.17
54 0.12
55 0.12
56 0.11
57 0.11
58 0.11
59 0.11
60 0.17
61 0.17
62 0.17
63 0.17
64 0.19
65 0.19
66 0.18
67 0.19
68 0.14
69 0.16
70 0.17
71 0.21
72 0.2
73 0.2
74 0.2
75 0.21
76 0.24