Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3I0E3

Protein Details
Accession A0A0C3I0E3    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-32VTTLGKPATIPRRRPRRREEADRVMASHydrophilic
NLS Segment(s)
PositionSequence
16-23PRRRPRRR
Subcellular Location(s) mito 16.5, mito_nucl 13, nucl 8.5
Family & Domain DBs
Amino Acid Sequences MSTNDVTTLGKPATIPRRRPRRREEADRVMASVLGHRDANPVHRPSTGHPNPAWESIPSLAWECRQPSTSEPLGKSQASFETSFDARRVVKPLAMVMRAFPEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.46
3 0.53
4 0.64
5 0.73
6 0.82
7 0.84
8 0.84
9 0.86
10 0.87
11 0.87
12 0.86
13 0.84
14 0.75
15 0.67
16 0.56
17 0.46
18 0.35
19 0.28
20 0.18
21 0.12
22 0.11
23 0.1
24 0.12
25 0.12
26 0.17
27 0.2
28 0.21
29 0.21
30 0.22
31 0.23
32 0.24
33 0.35
34 0.32
35 0.3
36 0.28
37 0.32
38 0.32
39 0.33
40 0.31
41 0.2
42 0.19
43 0.15
44 0.16
45 0.12
46 0.12
47 0.1
48 0.11
49 0.13
50 0.13
51 0.14
52 0.15
53 0.16
54 0.17
55 0.23
56 0.27
57 0.29
58 0.29
59 0.31
60 0.33
61 0.32
62 0.3
63 0.25
64 0.24
65 0.22
66 0.21
67 0.18
68 0.19
69 0.2
70 0.21
71 0.2
72 0.21
73 0.19
74 0.21
75 0.26
76 0.23
77 0.23
78 0.23
79 0.29
80 0.3
81 0.31
82 0.28
83 0.25