Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3GJX0

Protein Details
Accession A0A0C3GJX0    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAPAATGAKKQKKKWYDKAQHSVILHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5mito_nucl 12.5, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGAKKQKKKWYDKAQHSVILDKATSERLYKDVQSYRLVTVATLVDRLKINGSLARRCLADLEEKGQIKKVVGHSKLSIYTRAVAAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.85
4 0.87
5 0.89
6 0.84
7 0.78
8 0.69
9 0.61
10 0.51
11 0.42
12 0.32
13 0.23
14 0.19
15 0.17
16 0.16
17 0.14
18 0.13
19 0.14
20 0.16
21 0.17
22 0.22
23 0.23
24 0.25
25 0.27
26 0.27
27 0.25
28 0.24
29 0.23
30 0.17
31 0.14
32 0.12
33 0.09
34 0.09
35 0.08
36 0.09
37 0.09
38 0.09
39 0.09
40 0.09
41 0.1
42 0.11
43 0.15
44 0.16
45 0.18
46 0.19
47 0.18
48 0.18
49 0.18
50 0.17
51 0.19
52 0.18
53 0.19
54 0.24
55 0.25
56 0.26
57 0.28
58 0.28
59 0.23
60 0.26
61 0.32
62 0.35
63 0.36
64 0.4
65 0.39
66 0.42
67 0.47
68 0.44
69 0.39
70 0.31
71 0.31
72 0.27