Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3CAF6

Protein Details
Accession A0A0C3CAF6    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
192-219SKASVDSTPIKRPKKKRKKGDAFDDIFDHydrophilic
NLS Segment(s)
PositionSequence
200-210PIKRPKKKRKK
Subcellular Location(s) mito 12, cyto 5.5, cyto_nucl 4, plas 3, E.R. 3, nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR047205  RMP1  
IPR047204  RMP1_RBD  
Gene Ontology GO:0000172  C:ribonuclease MRP complex  
GO:0042134  F:rRNA primary transcript binding  
CDD cd22573  RMP1_RBD  
Amino Acid Sequences MTPLPPHPELQSVVSMLSAFAHRNKNQHRLSKWWKPFSQLRRHVSSLVRELEVAHREEQRYGAGHRKGVAGREVVERRAGFLIAALVPRAFVAFSMLVADNQYAALGLMLLATLARVRKLILPLVGEAKSKDEGLEDAMEAVEQSGLDLGEVIPRDEIPGRSAKVDGEEVQNGTAMKKLKKERVSGNEEPPSKASVDSTPIKRPKKKRKKGDAFDDIFDSLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.13
4 0.12
5 0.11
6 0.11
7 0.16
8 0.25
9 0.27
10 0.37
11 0.44
12 0.53
13 0.59
14 0.66
15 0.65
16 0.67
17 0.74
18 0.75
19 0.78
20 0.77
21 0.71
22 0.69
23 0.74
24 0.73
25 0.75
26 0.74
27 0.7
28 0.68
29 0.68
30 0.65
31 0.61
32 0.57
33 0.52
34 0.45
35 0.39
36 0.32
37 0.31
38 0.31
39 0.3
40 0.26
41 0.22
42 0.23
43 0.24
44 0.25
45 0.24
46 0.21
47 0.2
48 0.21
49 0.27
50 0.25
51 0.26
52 0.26
53 0.29
54 0.28
55 0.28
56 0.28
57 0.21
58 0.2
59 0.26
60 0.26
61 0.24
62 0.26
63 0.24
64 0.23
65 0.22
66 0.2
67 0.12
68 0.11
69 0.11
70 0.08
71 0.08
72 0.07
73 0.06
74 0.06
75 0.06
76 0.06
77 0.04
78 0.03
79 0.05
80 0.05
81 0.05
82 0.07
83 0.07
84 0.07
85 0.08
86 0.08
87 0.06
88 0.05
89 0.05
90 0.03
91 0.03
92 0.03
93 0.02
94 0.02
95 0.02
96 0.02
97 0.02
98 0.02
99 0.02
100 0.03
101 0.03
102 0.04
103 0.04
104 0.05
105 0.07
106 0.09
107 0.11
108 0.11
109 0.12
110 0.12
111 0.15
112 0.16
113 0.14
114 0.13
115 0.13
116 0.13
117 0.12
118 0.11
119 0.09
120 0.08
121 0.09
122 0.09
123 0.07
124 0.07
125 0.07
126 0.06
127 0.06
128 0.05
129 0.04
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.04
136 0.03
137 0.06
138 0.06
139 0.07
140 0.06
141 0.06
142 0.08
143 0.1
144 0.11
145 0.11
146 0.16
147 0.16
148 0.17
149 0.18
150 0.17
151 0.17
152 0.19
153 0.19
154 0.18
155 0.18
156 0.18
157 0.18
158 0.19
159 0.16
160 0.14
161 0.16
162 0.17
163 0.18
164 0.25
165 0.33
166 0.41
167 0.47
168 0.53
169 0.6
170 0.64
171 0.71
172 0.69
173 0.7
174 0.7
175 0.65
176 0.61
177 0.53
178 0.45
179 0.37
180 0.31
181 0.24
182 0.19
183 0.23
184 0.28
185 0.32
186 0.4
187 0.48
188 0.57
189 0.65
190 0.73
191 0.79
192 0.83
193 0.89
194 0.9
195 0.93
196 0.94
197 0.95
198 0.95
199 0.94
200 0.87
201 0.79
202 0.72