Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3GQH3

Protein Details
Accession A0A0C3GQH3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
8-31TLRFIHSLPKHKRHPLQDKFKNADHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
Amino Acid Sequences MSDNSLQTLRFIHSLPKHKRHPLQDKFKNADPLAIGLREDMLVFDPRKRVKASEGLAHEYLSLYCTTTRQMSPSQKRNFTGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.48
3 0.55
4 0.61
5 0.68
6 0.75
7 0.77
8 0.8
9 0.8
10 0.82
11 0.81
12 0.82
13 0.78
14 0.75
15 0.72
16 0.61
17 0.53
18 0.42
19 0.35
20 0.27
21 0.22
22 0.17
23 0.1
24 0.1
25 0.08
26 0.07
27 0.05
28 0.05
29 0.08
30 0.09
31 0.11
32 0.16
33 0.17
34 0.2
35 0.21
36 0.21
37 0.22
38 0.29
39 0.31
40 0.32
41 0.34
42 0.36
43 0.36
44 0.34
45 0.3
46 0.23
47 0.2
48 0.15
49 0.11
50 0.08
51 0.08
52 0.09
53 0.11
54 0.14
55 0.15
56 0.18
57 0.26
58 0.36
59 0.46
60 0.55
61 0.62
62 0.65