Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3D5S3

Protein Details
Accession A0A0C3D5S3    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
132-169EEKPKEEKPKEQKANKKTRKVIKKETKKENVKPKPAAKBasic
NLS Segment(s)
PositionSequence
134-172KPKEEKPKEQKANKKTRKVIKKETKKENVKPKPAAKTKR
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
Amino Acid Sequences MCLQVTQYYHSCDCKRIRHMVCLRHVDHTHKQLDNAPCPDLELRYIETQEVGCGHERGRQECKTETTYAFEPWTDRRYKACDWRFCEERLPGEKHECENGSWMMGRDHSCGIGREEYQWWRHRTAEEEIRVEEKPKEEKPKEQKANKKTRKVIKKETKKENVKPKPAAKTKREDTPQLKVQFADSASADLEMEEGIEKLKIEDSMEDGNKDVGDQRDAKKVKLGKGKVQLEKRVGNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.56
3 0.61
4 0.61
5 0.64
6 0.7
7 0.71
8 0.72
9 0.72
10 0.67
11 0.65
12 0.64
13 0.6
14 0.6
15 0.59
16 0.57
17 0.5
18 0.5
19 0.5
20 0.54
21 0.54
22 0.49
23 0.43
24 0.35
25 0.37
26 0.36
27 0.29
28 0.23
29 0.18
30 0.18
31 0.19
32 0.2
33 0.18
34 0.17
35 0.16
36 0.16
37 0.14
38 0.13
39 0.12
40 0.12
41 0.13
42 0.16
43 0.19
44 0.23
45 0.29
46 0.31
47 0.33
48 0.35
49 0.39
50 0.39
51 0.4
52 0.36
53 0.34
54 0.32
55 0.3
56 0.27
57 0.23
58 0.21
59 0.21
60 0.25
61 0.23
62 0.23
63 0.24
64 0.29
65 0.34
66 0.43
67 0.48
68 0.51
69 0.53
70 0.58
71 0.58
72 0.54
73 0.53
74 0.45
75 0.42
76 0.4
77 0.38
78 0.34
79 0.36
80 0.37
81 0.33
82 0.34
83 0.29
84 0.23
85 0.23
86 0.2
87 0.16
88 0.14
89 0.14
90 0.11
91 0.12
92 0.13
93 0.12
94 0.12
95 0.12
96 0.12
97 0.12
98 0.14
99 0.13
100 0.13
101 0.13
102 0.15
103 0.17
104 0.22
105 0.27
106 0.28
107 0.28
108 0.29
109 0.28
110 0.29
111 0.32
112 0.34
113 0.31
114 0.3
115 0.29
116 0.3
117 0.29
118 0.27
119 0.22
120 0.18
121 0.2
122 0.23
123 0.33
124 0.33
125 0.42
126 0.5
127 0.6
128 0.66
129 0.7
130 0.74
131 0.75
132 0.84
133 0.84
134 0.84
135 0.81
136 0.81
137 0.83
138 0.83
139 0.84
140 0.83
141 0.85
142 0.85
143 0.88
144 0.88
145 0.87
146 0.87
147 0.87
148 0.86
149 0.84
150 0.82
151 0.79
152 0.78
153 0.78
154 0.79
155 0.74
156 0.74
157 0.69
158 0.71
159 0.68
160 0.67
161 0.63
162 0.62
163 0.64
164 0.57
165 0.54
166 0.45
167 0.42
168 0.36
169 0.31
170 0.25
171 0.16
172 0.14
173 0.13
174 0.13
175 0.12
176 0.08
177 0.08
178 0.05
179 0.05
180 0.05
181 0.04
182 0.05
183 0.05
184 0.06
185 0.06
186 0.08
187 0.08
188 0.09
189 0.1
190 0.13
191 0.2
192 0.21
193 0.21
194 0.2
195 0.21
196 0.19
197 0.19
198 0.2
199 0.15
200 0.19
201 0.24
202 0.26
203 0.35
204 0.37
205 0.38
206 0.41
207 0.45
208 0.48
209 0.53
210 0.56
211 0.55
212 0.64
213 0.72
214 0.74
215 0.77
216 0.77
217 0.74