Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3DCX5

Protein Details
Accession A0A0C3DCX5   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
73-102EDEEKAKKEKKMEKEKTKKQRRSEAITEKVBasic
NLS Segment(s)
PositionSequence
77-94KAKKEKKMEKEKTKKQRR
Subcellular Location(s) nucl 17.5, mito_nucl 12.166, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MVHPTVSLDGKIWRSKQAETTLANGEKVKGSFKYIRRHRDHQGSSGGGGGEAEGGGGRKDTKEGEQGDKEEEEDEEKAKKEKKMEKEKTKKQRRSEAITEKVATEDDGSYAKQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.42
4 0.43
5 0.44
6 0.4
7 0.42
8 0.41
9 0.4
10 0.39
11 0.33
12 0.27
13 0.24
14 0.23
15 0.22
16 0.16
17 0.21
18 0.26
19 0.33
20 0.42
21 0.48
22 0.58
23 0.63
24 0.67
25 0.7
26 0.73
27 0.69
28 0.63
29 0.59
30 0.49
31 0.42
32 0.37
33 0.29
34 0.18
35 0.15
36 0.1
37 0.05
38 0.04
39 0.04
40 0.02
41 0.03
42 0.03
43 0.03
44 0.04
45 0.04
46 0.05
47 0.06
48 0.08
49 0.13
50 0.16
51 0.21
52 0.23
53 0.24
54 0.25
55 0.24
56 0.23
57 0.17
58 0.15
59 0.12
60 0.11
61 0.11
62 0.12
63 0.13
64 0.17
65 0.22
66 0.25
67 0.31
68 0.39
69 0.48
70 0.57
71 0.67
72 0.74
73 0.8
74 0.88
75 0.9
76 0.93
77 0.92
78 0.9
79 0.9
80 0.86
81 0.84
82 0.84
83 0.83
84 0.79
85 0.76
86 0.67
87 0.57
88 0.5
89 0.41
90 0.31
91 0.23
92 0.16
93 0.12
94 0.13