Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3GQD6

Protein Details
Accession A0A0C3GQD6   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-41QAPTKKFRKGTPKSRNGCITCKIRRIKCDESKPSCKKCSNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 12, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MQAPTKKFRKGTPKSRNGCITCKIRRIKCDESKPSCKKCSNTGRKCDGYNYPSTTDPQKPFLQSLSLHSSLTQPERRFLNFFYHHTAPILSGCFDSEFWVKLLPQVGHSEPTIQHAMIAVAAGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.84
4 0.77
5 0.72
6 0.69
7 0.68
8 0.64
9 0.67
10 0.68
11 0.65
12 0.67
13 0.69
14 0.71
15 0.72
16 0.75
17 0.76
18 0.76
19 0.81
20 0.84
21 0.83
22 0.81
23 0.77
24 0.69
25 0.69
26 0.71
27 0.71
28 0.71
29 0.72
30 0.72
31 0.69
32 0.67
33 0.61
34 0.57
35 0.49
36 0.45
37 0.4
38 0.34
39 0.32
40 0.32
41 0.33
42 0.32
43 0.3
44 0.29
45 0.28
46 0.27
47 0.27
48 0.26
49 0.24
50 0.18
51 0.2
52 0.22
53 0.2
54 0.19
55 0.19
56 0.19
57 0.19
58 0.24
59 0.25
60 0.2
61 0.23
62 0.25
63 0.27
64 0.27
65 0.27
66 0.31
67 0.29
68 0.31
69 0.35
70 0.34
71 0.32
72 0.31
73 0.3
74 0.21
75 0.19
76 0.17
77 0.11
78 0.1
79 0.1
80 0.1
81 0.1
82 0.13
83 0.12
84 0.12
85 0.12
86 0.14
87 0.13
88 0.15
89 0.2
90 0.17
91 0.18
92 0.22
93 0.23
94 0.24
95 0.24
96 0.25
97 0.21
98 0.25
99 0.25
100 0.2
101 0.18
102 0.17
103 0.17
104 0.13