Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WVX3

Protein Details
Accession Q4WVX3    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-29ATPSAPKKARQSKLAKENDIHydrophilic
NLS Segment(s)
PositionSequence
4-19KKRSAPATPSAPKKAR
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
Gene Ontology GO:0005825  C:half bridge of spindle pole body  
GO:0044732  C:mitotic spindle pole body  
GO:0005509  F:calcium ion binding  
GO:0008017  F:microtubule binding  
GO:0030474  P:spindle pole body duplication  
KEGG afm:AFUA_5G13630  -  
Amino Acid Sequences MPPKKRSAPATPSAPKKARQSKLAKENDISAEEESEIKEVFHLFSTTAEEFPNEKEGVIAREDVRKALVALGLPPSDSSELHSILSAVDPTNTGFVPYAPFVSVAAAKLRSRSDEAMSAEVDAAFQLFTKGTDGPITLGHLRRIARELKEDNLGDELLKDMILEANGGAGVNAGVTLEQFHDVMTRAGVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.68
3 0.71
4 0.73
5 0.7
6 0.71
7 0.73
8 0.73
9 0.79
10 0.82
11 0.76
12 0.67
13 0.65
14 0.59
15 0.51
16 0.43
17 0.33
18 0.25
19 0.21
20 0.2
21 0.15
22 0.13
23 0.11
24 0.09
25 0.09
26 0.08
27 0.09
28 0.09
29 0.09
30 0.08
31 0.09
32 0.14
33 0.14
34 0.14
35 0.14
36 0.14
37 0.14
38 0.15
39 0.19
40 0.14
41 0.13
42 0.13
43 0.14
44 0.14
45 0.14
46 0.14
47 0.12
48 0.17
49 0.17
50 0.17
51 0.16
52 0.15
53 0.14
54 0.13
55 0.12
56 0.08
57 0.08
58 0.1
59 0.09
60 0.09
61 0.08
62 0.09
63 0.09
64 0.09
65 0.1
66 0.11
67 0.11
68 0.11
69 0.11
70 0.1
71 0.09
72 0.09
73 0.07
74 0.05
75 0.05
76 0.05
77 0.05
78 0.06
79 0.06
80 0.06
81 0.05
82 0.06
83 0.07
84 0.07
85 0.07
86 0.06
87 0.07
88 0.06
89 0.07
90 0.07
91 0.06
92 0.08
93 0.1
94 0.09
95 0.12
96 0.12
97 0.13
98 0.16
99 0.17
100 0.17
101 0.19
102 0.21
103 0.2
104 0.2
105 0.18
106 0.15
107 0.13
108 0.11
109 0.07
110 0.05
111 0.03
112 0.03
113 0.04
114 0.04
115 0.04
116 0.06
117 0.06
118 0.07
119 0.08
120 0.08
121 0.09
122 0.09
123 0.12
124 0.15
125 0.16
126 0.17
127 0.21
128 0.21
129 0.22
130 0.25
131 0.27
132 0.26
133 0.32
134 0.33
135 0.32
136 0.38
137 0.36
138 0.33
139 0.3
140 0.27
141 0.2
142 0.17
143 0.15
144 0.09
145 0.08
146 0.07
147 0.06
148 0.06
149 0.06
150 0.06
151 0.05
152 0.05
153 0.06
154 0.06
155 0.05
156 0.04
157 0.04
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.04
164 0.06
165 0.07
166 0.07
167 0.07
168 0.09
169 0.11
170 0.11