Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3GV06

Protein Details
Accession A0A0C3GV06    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
19-41NEESPKRSHRTKAKEQKPKEARYBasic
NLS Segment(s)
PositionSequence
25-36RSHRTKAKEQKP
Subcellular Location(s) nucl 14.5, cyto_nucl 11.333, cyto 7, cyto_pero 5.333, pero 2.5
Family & Domain DBs
Amino Acid Sequences MPQGEMTEAGSSAQDGNQNEESPKRSHRTKAKEQKPKEARYSTDDIVWLAISGKPGSYKMTVVDRAQHLETKKWEYQLKDTDGELYERGKWVPEAQLNSKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.18
4 0.2
5 0.21
6 0.22
7 0.25
8 0.27
9 0.26
10 0.32
11 0.33
12 0.36
13 0.43
14 0.52
15 0.57
16 0.65
17 0.73
18 0.77
19 0.81
20 0.8
21 0.83
22 0.82
23 0.79
24 0.76
25 0.7
26 0.62
27 0.58
28 0.58
29 0.48
30 0.4
31 0.33
32 0.25
33 0.21
34 0.18
35 0.11
36 0.07
37 0.07
38 0.06
39 0.06
40 0.06
41 0.06
42 0.07
43 0.09
44 0.09
45 0.09
46 0.11
47 0.15
48 0.18
49 0.18
50 0.22
51 0.21
52 0.24
53 0.24
54 0.26
55 0.23
56 0.25
57 0.28
58 0.31
59 0.32
60 0.34
61 0.38
62 0.37
63 0.43
64 0.46
65 0.46
66 0.41
67 0.39
68 0.37
69 0.34
70 0.32
71 0.26
72 0.21
73 0.18
74 0.17
75 0.18
76 0.16
77 0.16
78 0.17
79 0.23
80 0.28
81 0.33