Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3C8A0

Protein Details
Accession A0A0C3C8A0   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
158-186VTDSIGKKKRVRKSKKKGKGKKSDSNLSPBasic
NLS Segment(s)
PositionSequence
163-179GKKKRVRKSKKKGKGKK
Subcellular Location(s) nucl 16.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR036533  BAG_dom_sf  
IPR003103  BAG_domain  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0051087  F:protein-folding chaperone binding  
Pfam View protein in Pfam  
PF02179  BAG  
PROSITE View protein in PROSITE  
PS51035  BAG  
CDD cd17039  Ubl_ubiquitin_like  
Amino Acid Sequences MNRWTGSFPFGGSRLSPFGRSQYHPHVTENDYSYITSDDLAAPPRAYDPRRPHGYPSMVAEDDVLLLRYKTITYRVQFPAYSIGDGKLQVRDIKERARVILGLPEGSEQRMKLLYKGQQLKDPHRPCRDYNLKNQSEVLCIVGEAPEPSEDSDGSESVTDSIGKKKRVRKSKKKGKGKKSDSNLSPDVGTSEEQSRGTSPSPAPKTALEKLNAISSHFHTKILPLCVQFTAAPPQDVKKKDFEHKKLTETIMNEVMLKLDAVDTDGDPEIREKRRALVRETQGVLNGLDEAAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.27
4 0.25
5 0.3
6 0.34
7 0.37
8 0.41
9 0.46
10 0.51
11 0.5
12 0.52
13 0.51
14 0.48
15 0.5
16 0.46
17 0.39
18 0.32
19 0.3
20 0.28
21 0.24
22 0.2
23 0.15
24 0.12
25 0.11
26 0.12
27 0.15
28 0.15
29 0.14
30 0.14
31 0.18
32 0.23
33 0.25
34 0.33
35 0.39
36 0.47
37 0.55
38 0.56
39 0.58
40 0.6
41 0.61
42 0.55
43 0.51
44 0.47
45 0.4
46 0.38
47 0.32
48 0.24
49 0.19
50 0.17
51 0.12
52 0.07
53 0.06
54 0.07
55 0.07
56 0.07
57 0.08
58 0.13
59 0.19
60 0.21
61 0.29
62 0.32
63 0.35
64 0.34
65 0.34
66 0.36
67 0.3
68 0.29
69 0.22
70 0.19
71 0.18
72 0.19
73 0.19
74 0.13
75 0.14
76 0.16
77 0.17
78 0.21
79 0.24
80 0.29
81 0.33
82 0.33
83 0.32
84 0.31
85 0.29
86 0.24
87 0.25
88 0.2
89 0.14
90 0.13
91 0.13
92 0.12
93 0.13
94 0.13
95 0.08
96 0.09
97 0.12
98 0.12
99 0.13
100 0.18
101 0.22
102 0.3
103 0.37
104 0.37
105 0.4
106 0.45
107 0.5
108 0.55
109 0.57
110 0.57
111 0.57
112 0.59
113 0.55
114 0.61
115 0.64
116 0.58
117 0.61
118 0.63
119 0.57
120 0.54
121 0.54
122 0.45
123 0.36
124 0.32
125 0.22
126 0.11
127 0.1
128 0.09
129 0.07
130 0.06
131 0.05
132 0.05
133 0.04
134 0.05
135 0.05
136 0.06
137 0.05
138 0.06
139 0.07
140 0.07
141 0.07
142 0.07
143 0.06
144 0.06
145 0.06
146 0.06
147 0.06
148 0.14
149 0.18
150 0.24
151 0.3
152 0.38
153 0.46
154 0.56
155 0.67
156 0.71
157 0.78
158 0.84
159 0.88
160 0.92
161 0.94
162 0.93
163 0.93
164 0.92
165 0.89
166 0.86
167 0.84
168 0.76
169 0.72
170 0.63
171 0.53
172 0.43
173 0.34
174 0.26
175 0.18
176 0.16
177 0.11
178 0.11
179 0.12
180 0.12
181 0.13
182 0.13
183 0.14
184 0.15
185 0.17
186 0.17
187 0.24
188 0.27
189 0.28
190 0.29
191 0.3
192 0.35
193 0.36
194 0.4
195 0.32
196 0.3
197 0.3
198 0.33
199 0.3
200 0.26
201 0.23
202 0.21
203 0.28
204 0.26
205 0.26
206 0.22
207 0.24
208 0.28
209 0.3
210 0.3
211 0.23
212 0.24
213 0.24
214 0.25
215 0.23
216 0.2
217 0.23
218 0.21
219 0.22
220 0.21
221 0.25
222 0.31
223 0.35
224 0.35
225 0.36
226 0.41
227 0.49
228 0.59
229 0.62
230 0.65
231 0.66
232 0.68
233 0.65
234 0.63
235 0.58
236 0.49
237 0.46
238 0.38
239 0.34
240 0.29
241 0.24
242 0.21
243 0.17
244 0.14
245 0.1
246 0.07
247 0.06
248 0.07
249 0.08
250 0.07
251 0.1
252 0.11
253 0.11
254 0.11
255 0.15
256 0.21
257 0.25
258 0.29
259 0.28
260 0.35
261 0.44
262 0.48
263 0.51
264 0.54
265 0.56
266 0.6
267 0.62
268 0.56
269 0.49
270 0.46
271 0.4
272 0.3
273 0.23
274 0.14