Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3GRE8

Protein Details
Accession A0A0C3GRE8    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
97-116RSESQHTVRYKPKRKDPPRLBasic
NLS Segment(s)
PositionSequence
108-111PKRK
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MAPPAKDKGKARDASCRPPEPQGSTQHPAPFESDPLDQEPFESLDQQANLLALQHAQVKSQIEAKTAQKQIEKLEAMVAQLLQNPTPPRASLEPTTRSESQHTVRYKPKRKDPPRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.7
3 0.66
4 0.59
5 0.59
6 0.61
7 0.57
8 0.56
9 0.53
10 0.53
11 0.52
12 0.54
13 0.5
14 0.46
15 0.39
16 0.37
17 0.3
18 0.24
19 0.22
20 0.19
21 0.17
22 0.19
23 0.2
24 0.16
25 0.15
26 0.15
27 0.14
28 0.13
29 0.12
30 0.1
31 0.11
32 0.11
33 0.11
34 0.1
35 0.08
36 0.07
37 0.07
38 0.06
39 0.04
40 0.05
41 0.08
42 0.08
43 0.08
44 0.1
45 0.11
46 0.11
47 0.17
48 0.17
49 0.14
50 0.18
51 0.21
52 0.27
53 0.29
54 0.31
55 0.27
56 0.28
57 0.29
58 0.32
59 0.29
60 0.22
61 0.21
62 0.19
63 0.17
64 0.16
65 0.14
66 0.08
67 0.11
68 0.11
69 0.09
70 0.13
71 0.14
72 0.15
73 0.16
74 0.16
75 0.18
76 0.2
77 0.25
78 0.28
79 0.33
80 0.37
81 0.4
82 0.46
83 0.43
84 0.42
85 0.41
86 0.42
87 0.39
88 0.42
89 0.42
90 0.44
91 0.52
92 0.61
93 0.67
94 0.7
95 0.77
96 0.8