Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7S6U8

Protein Details
Accession R7S6U8    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-54MSSRREPIRRDRSRDREDRSSGRDRYPPRGAPRRSRSRSPPRRGERNWRGSDRRBasic
61-94REDDRRDRDRRDDRRDDRRDDRRRDDRDRRDHGRBasic
207-226SADVKKMRTWRQYMNRRGGFHydrophilic
NLS Segment(s)
PositionSequence
5-105REPIRRDRSRDREDRSSGRDRYPPRGAPRRSRSRSPPRRGERNWRGSDRRDAPGRDREDDRRDRDRRDDRRDDRRDDRRRDDRDRRDHGRDAGREPLPPPR
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
KEGG tvs:TRAVEDRAFT_61437  -  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MSSRREPIRRDRSRDREDRSSGRDRYPPRGAPRRSRSRSPPRRGERNWRGSDRRDAPGRDREDDRRDRDRRDDRRDDRRDDRRRDDRDRRDHGRDAGREPLPPPRSDGDRVRDRDRDTRPVDRAPLQDSKPPPRIEPERQKSATGTPEVEATSSRPAVEPEASADGAEEGETMDATNEDDAAMMAMMGMSGFGTTKGKHVEGNQEGSADVKKMRTWRQYMNRRGGFNRPLDKIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.85
3 0.83
4 0.81
5 0.8
6 0.77
7 0.76
8 0.7
9 0.66
10 0.66
11 0.61
12 0.62
13 0.63
14 0.63
15 0.64
16 0.69
17 0.72
18 0.74
19 0.8
20 0.83
21 0.81
22 0.82
23 0.83
24 0.84
25 0.87
26 0.86
27 0.87
28 0.85
29 0.89
30 0.87
31 0.88
32 0.87
33 0.87
34 0.85
35 0.83
36 0.79
37 0.74
38 0.76
39 0.7
40 0.67
41 0.63
42 0.58
43 0.56
44 0.59
45 0.58
46 0.52
47 0.52
48 0.52
49 0.55
50 0.59
51 0.6
52 0.61
53 0.62
54 0.62
55 0.67
56 0.71
57 0.71
58 0.73
59 0.77
60 0.75
61 0.81
62 0.83
63 0.81
64 0.8
65 0.8
66 0.81
67 0.78
68 0.79
69 0.78
70 0.79
71 0.82
72 0.83
73 0.82
74 0.82
75 0.82
76 0.8
77 0.76
78 0.72
79 0.68
80 0.65
81 0.57
82 0.5
83 0.48
84 0.42
85 0.37
86 0.34
87 0.36
88 0.3
89 0.28
90 0.28
91 0.24
92 0.27
93 0.3
94 0.34
95 0.33
96 0.39
97 0.43
98 0.44
99 0.46
100 0.46
101 0.49
102 0.48
103 0.49
104 0.45
105 0.47
106 0.46
107 0.44
108 0.43
109 0.39
110 0.37
111 0.32
112 0.33
113 0.29
114 0.31
115 0.33
116 0.37
117 0.4
118 0.39
119 0.36
120 0.37
121 0.43
122 0.47
123 0.54
124 0.54
125 0.57
126 0.57
127 0.57
128 0.52
129 0.48
130 0.42
131 0.33
132 0.28
133 0.19
134 0.19
135 0.18
136 0.17
137 0.13
138 0.11
139 0.12
140 0.11
141 0.11
142 0.1
143 0.11
144 0.13
145 0.13
146 0.12
147 0.11
148 0.14
149 0.13
150 0.13
151 0.12
152 0.1
153 0.09
154 0.08
155 0.06
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.03
171 0.03
172 0.03
173 0.03
174 0.02
175 0.02
176 0.02
177 0.02
178 0.03
179 0.04
180 0.06
181 0.07
182 0.11
183 0.15
184 0.16
185 0.19
186 0.22
187 0.31
188 0.34
189 0.39
190 0.36
191 0.33
192 0.32
193 0.3
194 0.28
195 0.2
196 0.17
197 0.14
198 0.17
199 0.24
200 0.33
201 0.41
202 0.46
203 0.54
204 0.63
205 0.72
206 0.79
207 0.82
208 0.79
209 0.76
210 0.74
211 0.73
212 0.7
213 0.68
214 0.66