Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7S8A4

Protein Details
Accession R7S8A4    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
131-156ASGINPKTGRPYRRRKDGPKTPKMILHydrophilic
NLS Segment(s)
PositionSequence
99-151KAVMPGKPPVRPAPKCWGRQSRDDIGKARGRPASGINPKTGRPYRRRKDGPKT
Subcellular Location(s) mito 13, cyto 11, nucl 2
Family & Domain DBs
KEGG tvs:TRAVEDRAFT_128198  -  
tvs:TRAVEDRAFT_137850  -  
Amino Acid Sequences ESRAGPRIKMKWTAVEYANGVVVKGGHRLVGWPNRANEEPHDPNGPPLDPLDTIPFGNLSDIPGGQAVIQRLLDLWTSGKMYFERADEAFIDLAKRNPKAVMPGKPPVRPAPKCWGRQSRDDIGKARGRPASGINPKTGRPYRRRKDGPKTPKMILDSDIDSEDEVESDIGSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.45
3 0.4
4 0.33
5 0.33
6 0.25
7 0.21
8 0.15
9 0.14
10 0.12
11 0.13
12 0.12
13 0.1
14 0.1
15 0.12
16 0.2
17 0.27
18 0.31
19 0.33
20 0.35
21 0.39
22 0.41
23 0.41
24 0.37
25 0.38
26 0.37
27 0.35
28 0.37
29 0.32
30 0.33
31 0.33
32 0.29
33 0.21
34 0.17
35 0.17
36 0.14
37 0.15
38 0.16
39 0.15
40 0.14
41 0.14
42 0.13
43 0.11
44 0.11
45 0.1
46 0.07
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.06
53 0.08
54 0.08
55 0.08
56 0.08
57 0.07
58 0.07
59 0.08
60 0.08
61 0.06
62 0.07
63 0.06
64 0.08
65 0.08
66 0.09
67 0.08
68 0.1
69 0.11
70 0.11
71 0.12
72 0.11
73 0.12
74 0.11
75 0.12
76 0.1
77 0.09
78 0.09
79 0.08
80 0.11
81 0.13
82 0.13
83 0.13
84 0.14
85 0.14
86 0.21
87 0.27
88 0.31
89 0.33
90 0.4
91 0.44
92 0.45
93 0.48
94 0.47
95 0.51
96 0.46
97 0.46
98 0.49
99 0.53
100 0.57
101 0.64
102 0.66
103 0.6
104 0.65
105 0.67
106 0.65
107 0.64
108 0.62
109 0.56
110 0.53
111 0.55
112 0.48
113 0.46
114 0.39
115 0.33
116 0.31
117 0.32
118 0.36
119 0.39
120 0.4
121 0.41
122 0.41
123 0.42
124 0.5
125 0.53
126 0.51
127 0.52
128 0.61
129 0.65
130 0.74
131 0.83
132 0.84
133 0.87
134 0.9
135 0.91
136 0.9
137 0.87
138 0.79
139 0.75
140 0.68
141 0.59
142 0.5
143 0.43
144 0.35
145 0.31
146 0.28
147 0.23
148 0.19
149 0.18
150 0.15
151 0.11
152 0.1
153 0.08