Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7S8A4

Protein Details
Accession R7S8A4   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
131-156ASGINPKTGRPYRRRKDGPKTPKMILHydrophilic
NLS Segment(s)
PositionSequence
99-151KAVMPGKPPVRPAPKCWGRQSRDDIGKARGRPASGINPKTGRPYRRRKDGPKT
Subcellular Location(s) mito 13, cyto 11, nucl 2
Family & Domain DBs
KEGG tvs:TRAVEDRAFT_128198  -  
tvs:TRAVEDRAFT_137850  -  
Amino Acid Sequences ESRAGPRIKMKWTAVEYANGVVVKGGHRLVGWPNRANEEPHDPNGPPLDPLDTIPFGNLSDIPGGQAVIQRLLDLWTSGKMYFERADEAFIDLAKRNPKAVMPGKPPVRPAPKCWGRQSRDDIGKARGRPASGINPKTGRPYRRRKDGPKTPKMILDSDIDSEDEVESDIGSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.45
3 0.4
4 0.33
5 0.33
6 0.25
7 0.21
8 0.15
9 0.14
10 0.12
11 0.13
12 0.12
13 0.1
14 0.1
15 0.12
16 0.2
17 0.27
18 0.31
19 0.33
20 0.35
21 0.39
22 0.41
23 0.41
24 0.37
25 0.38
26 0.37
27 0.35
28 0.37
29 0.32
30 0.33
31 0.33
32 0.29
33 0.21
34 0.17
35 0.17
36 0.14
37 0.15
38 0.16
39 0.15
40 0.14
41 0.14
42 0.13
43 0.11
44 0.11
45 0.1
46 0.07
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.06
53 0.08
54 0.08
55 0.08
56 0.08
57 0.07
58 0.07
59 0.08
60 0.08
61 0.06
62 0.07
63 0.06
64 0.08
65 0.08
66 0.09
67 0.08
68 0.1
69 0.11
70 0.11
71 0.12
72 0.11
73 0.12
74 0.11
75 0.12
76 0.1
77 0.09
78 0.09
79 0.08
80 0.11
81 0.13
82 0.13
83 0.13
84 0.14
85 0.14
86 0.21
87 0.27
88 0.31
89 0.33
90 0.4
91 0.44
92 0.45
93 0.48
94 0.47
95 0.51
96 0.46
97 0.46
98 0.49
99 0.53
100 0.57
101 0.64
102 0.66
103 0.6
104 0.65
105 0.67
106 0.65
107 0.64
108 0.62
109 0.56
110 0.53
111 0.55
112 0.48
113 0.46
114 0.39
115 0.33
116 0.31
117 0.32
118 0.36
119 0.39
120 0.4
121 0.41
122 0.41
123 0.42
124 0.5
125 0.53
126 0.51
127 0.52
128 0.61
129 0.65
130 0.74
131 0.83
132 0.84
133 0.87
134 0.9
135 0.91
136 0.9
137 0.87
138 0.79
139 0.75
140 0.68
141 0.59
142 0.5
143 0.43
144 0.35
145 0.31
146 0.28
147 0.23
148 0.19
149 0.18
150 0.15
151 0.11
152 0.1
153 0.08