Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7S5Z4

Protein Details
Accession R7S5Z4    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20AYIQSKKKYKPVAQKVRAVLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, cyto_mito 11, nucl 6
Family & Domain DBs
KEGG tvs:TRAVEDRAFT_76102  -  
Amino Acid Sequences AYIQSKKKYKPVAQKVRAVLGTCPEKFRIERHITGDPLATMPKLSPTPPPFVPTGRYTQERKEAFDKAHGDDFLWAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.76
3 0.72
4 0.65
5 0.56
6 0.45
7 0.41
8 0.4
9 0.33
10 0.32
11 0.28
12 0.28
13 0.28
14 0.29
15 0.32
16 0.31
17 0.33
18 0.36
19 0.38
20 0.36
21 0.35
22 0.33
23 0.24
24 0.18
25 0.15
26 0.1
27 0.07
28 0.06
29 0.08
30 0.08
31 0.09
32 0.15
33 0.18
34 0.23
35 0.24
36 0.26
37 0.26
38 0.27
39 0.3
40 0.25
41 0.28
42 0.28
43 0.33
44 0.33
45 0.37
46 0.45
47 0.43
48 0.45
49 0.44
50 0.43
51 0.41
52 0.45
53 0.43
54 0.38
55 0.41
56 0.36
57 0.32
58 0.31