Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7S6I4

Protein Details
Accession R7S6I4    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
70-94ESTCYKKHPELRPQGKDKGKKKDKGBasic
NLS Segment(s)
PositionSequence
78-94PELRPQGKDKGKKKDKG
Subcellular Location(s) nucl 12.5, mito_nucl 11.5, mito 9.5, cyto 3
Family & Domain DBs
KEGG tvs:TRAVEDRAFT_76066  -  
Amino Acid Sequences LSKVPDSYRSMISALMATTELDNLTVDVILAKTLAEESMRKNGQAASRISQTKPKKTGPCGHCGSQTHHESTCYKKHPELRPQGKDKGKKKDKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.1
4 0.08
5 0.08
6 0.08
7 0.07
8 0.06
9 0.06
10 0.06
11 0.06
12 0.05
13 0.05
14 0.05
15 0.05
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.05
23 0.06
24 0.08
25 0.16
26 0.16
27 0.16
28 0.17
29 0.19
30 0.21
31 0.25
32 0.25
33 0.2
34 0.24
35 0.26
36 0.27
37 0.33
38 0.36
39 0.38
40 0.42
41 0.46
42 0.48
43 0.53
44 0.62
45 0.57
46 0.6
47 0.57
48 0.53
49 0.52
50 0.48
51 0.47
52 0.46
53 0.45
54 0.4
55 0.37
56 0.37
57 0.34
58 0.38
59 0.4
60 0.38
61 0.39
62 0.42
63 0.5
64 0.57
65 0.65
66 0.7
67 0.72
68 0.76
69 0.79
70 0.83
71 0.83
72 0.84
73 0.82
74 0.82