Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7S726

Protein Details
Accession R7S726   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
27-48GDIYRRSHGRQKRMRYAPQYYAHydrophilic
167-186EPKAWTQQRQDTKKRRARASHydrophilic
NLS Segment(s)
PositionSequence
180-184KRRAR
Subcellular Location(s) nucl 14, cyto_nucl 11, cyto 6, mito 5
Family & Domain DBs
KEGG tvs:TRAVEDRAFT_54233  -  
Amino Acid Sequences MSLKRKEPPHSWEGGEIKAEMQGCLNGDIYRRSHGRQKRMRYAPQYYALDIVLGCGLVIAGWPQDIPFTDLSAVGGGIDTLREIRRRWYLPDGDPEKLRFEPASREDYANAAHDPESVHPTPQHLPELKARAAAAKARAQALPVESDVYDSRNMRRVGRQSTSTMPEPKAWTQQRQDTKKRRARASDMETRVRKKRQTTGVTSMPFVLQGADKVSGGDGEQGSDSEEAYTLDDPITDFNLTRSFGGELSDDPIKDASDSKREKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.42
3 0.35
4 0.28
5 0.26
6 0.24
7 0.17
8 0.14
9 0.13
10 0.13
11 0.14
12 0.15
13 0.13
14 0.15
15 0.19
16 0.2
17 0.24
18 0.26
19 0.28
20 0.37
21 0.44
22 0.53
23 0.58
24 0.66
25 0.71
26 0.77
27 0.83
28 0.82
29 0.82
30 0.77
31 0.76
32 0.69
33 0.59
34 0.51
35 0.41
36 0.33
37 0.25
38 0.19
39 0.1
40 0.07
41 0.06
42 0.04
43 0.04
44 0.03
45 0.03
46 0.03
47 0.03
48 0.04
49 0.04
50 0.04
51 0.05
52 0.06
53 0.08
54 0.08
55 0.09
56 0.09
57 0.1
58 0.1
59 0.09
60 0.08
61 0.06
62 0.05
63 0.04
64 0.03
65 0.03
66 0.03
67 0.05
68 0.07
69 0.1
70 0.11
71 0.16
72 0.23
73 0.25
74 0.3
75 0.35
76 0.39
77 0.4
78 0.49
79 0.48
80 0.43
81 0.44
82 0.4
83 0.36
84 0.31
85 0.29
86 0.2
87 0.17
88 0.21
89 0.22
90 0.26
91 0.24
92 0.25
93 0.24
94 0.24
95 0.24
96 0.19
97 0.16
98 0.11
99 0.1
100 0.09
101 0.1
102 0.1
103 0.15
104 0.13
105 0.14
106 0.13
107 0.16
108 0.18
109 0.19
110 0.22
111 0.18
112 0.2
113 0.23
114 0.28
115 0.25
116 0.24
117 0.22
118 0.19
119 0.19
120 0.19
121 0.17
122 0.16
123 0.17
124 0.17
125 0.17
126 0.16
127 0.16
128 0.15
129 0.13
130 0.1
131 0.1
132 0.08
133 0.1
134 0.09
135 0.1
136 0.12
137 0.11
138 0.13
139 0.19
140 0.2
141 0.21
142 0.26
143 0.31
144 0.35
145 0.38
146 0.39
147 0.35
148 0.38
149 0.4
150 0.39
151 0.37
152 0.32
153 0.32
154 0.33
155 0.32
156 0.37
157 0.37
158 0.4
159 0.41
160 0.48
161 0.55
162 0.6
163 0.68
164 0.69
165 0.76
166 0.77
167 0.8
168 0.79
169 0.76
170 0.75
171 0.75
172 0.72
173 0.71
174 0.69
175 0.7
176 0.68
177 0.67
178 0.67
179 0.64
180 0.62
181 0.59
182 0.62
183 0.63
184 0.65
185 0.67
186 0.66
187 0.67
188 0.63
189 0.57
190 0.49
191 0.39
192 0.31
193 0.23
194 0.16
195 0.09
196 0.08
197 0.1
198 0.1
199 0.1
200 0.1
201 0.1
202 0.09
203 0.09
204 0.12
205 0.1
206 0.1
207 0.1
208 0.1
209 0.12
210 0.11
211 0.11
212 0.08
213 0.08
214 0.08
215 0.09
216 0.1
217 0.08
218 0.08
219 0.08
220 0.08
221 0.09
222 0.11
223 0.1
224 0.1
225 0.11
226 0.15
227 0.16
228 0.16
229 0.16
230 0.15
231 0.15
232 0.16
233 0.15
234 0.13
235 0.16
236 0.19
237 0.17
238 0.17
239 0.18
240 0.17
241 0.17
242 0.21
243 0.22
244 0.29