Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7S6W9

Protein Details
Accession R7S6W9   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
42-65GINPKTGRPYRRRKDGPKTPKMILBasic
NLS Segment(s)
PositionSequence
16-60RNPKAVMPGKPPSRDDIGKARGRPASGINPKTGRPYRRRKDGPKT
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
KEGG tvs:TRAVEDRAFT_54648  -  
Amino Acid Sequences MYFERADEAFIDLAKRNPKAVMPGKPPSRDDIGKARGRPASGINPKTGRPYRRRKDGPKTPKMILDSDIDSEDEVESDIGSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.22
4 0.23
5 0.24
6 0.31
7 0.37
8 0.4
9 0.41
10 0.49
11 0.54
12 0.57
13 0.57
14 0.51
15 0.49
16 0.42
17 0.39
18 0.38
19 0.4
20 0.41
21 0.4
22 0.4
23 0.36
24 0.36
25 0.33
26 0.27
27 0.29
28 0.32
29 0.33
30 0.32
31 0.33
32 0.33
33 0.4
34 0.43
35 0.41
36 0.43
37 0.53
38 0.57
39 0.67
40 0.75
41 0.77
42 0.82
43 0.86
44 0.87
45 0.86
46 0.83
47 0.75
48 0.71
49 0.64
50 0.55
51 0.46
52 0.39
53 0.31
54 0.27
55 0.25
56 0.2
57 0.17
58 0.16
59 0.14
60 0.1
61 0.09
62 0.07