Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7S6H4

Protein Details
Accession R7S6H4   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-24APPYDPPTPRRRPYTPRGRPASAHydrophilic
NLS Segment(s)
PositionSequence
11-59RRRPYTPRGRPASAPDMLRARARRAERAGGGAPAAKTVRPRASAAPRRR
Subcellular Location(s) mito 10, cyto 9, nucl 7
Family & Domain DBs
KEGG tvs:TRAVEDRAFT_54846  -  
Amino Acid Sequences MAPPYDPPTPRRRPYTPRGRPASAPDMLRARARRAERAGGGAPAAKTVRPRASAAPRRRENAAARCTPQGRHTSLCVPRCVWARSTGVDGGCVVRDDGGGGAASVDKWTERADDALRGLENARA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.8
3 0.81
4 0.81
5 0.81
6 0.77
7 0.72
8 0.7
9 0.66
10 0.59
11 0.5
12 0.44
13 0.4
14 0.38
15 0.41
16 0.36
17 0.33
18 0.36
19 0.38
20 0.4
21 0.4
22 0.43
23 0.38
24 0.4
25 0.37
26 0.3
27 0.27
28 0.23
29 0.18
30 0.16
31 0.15
32 0.12
33 0.13
34 0.17
35 0.2
36 0.2
37 0.22
38 0.26
39 0.36
40 0.45
41 0.51
42 0.57
43 0.57
44 0.56
45 0.56
46 0.55
47 0.51
48 0.5
49 0.47
50 0.4
51 0.38
52 0.39
53 0.39
54 0.35
55 0.33
56 0.29
57 0.27
58 0.26
59 0.26
60 0.31
61 0.36
62 0.38
63 0.36
64 0.32
65 0.33
66 0.36
67 0.35
68 0.28
69 0.26
70 0.25
71 0.24
72 0.26
73 0.25
74 0.2
75 0.19
76 0.18
77 0.15
78 0.13
79 0.12
80 0.09
81 0.07
82 0.07
83 0.07
84 0.06
85 0.06
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.06
93 0.05
94 0.06
95 0.08
96 0.09
97 0.1
98 0.14
99 0.16
100 0.19
101 0.21
102 0.23
103 0.22
104 0.21