Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7S679

Protein Details
Accession R7S679   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
20-39AFLSTKKKYKPVARKVRPVLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11.5, cyto 11, nucl 10, mito 3
Family & Domain DBs
KEGG tvs:TRAVEDRAFT_80274  -  
Amino Acid Sequences VFPGAVHPEAPPDPERTAEAFLSTKKKYKPVARKVRPVLGSTPEQFRVERNITGDPLADMPELPTNPTDFVPTGRYTAERQEAFDKAHSEDFLWPEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.23
4 0.25
5 0.22
6 0.22
7 0.2
8 0.23
9 0.28
10 0.28
11 0.32
12 0.32
13 0.38
14 0.44
15 0.52
16 0.59
17 0.63
18 0.72
19 0.74
20 0.81
21 0.8
22 0.79
23 0.71
24 0.63
25 0.55
26 0.47
27 0.42
28 0.34
29 0.32
30 0.27
31 0.26
32 0.23
33 0.21
34 0.23
35 0.21
36 0.2
37 0.19
38 0.18
39 0.18
40 0.18
41 0.17
42 0.11
43 0.1
44 0.1
45 0.08
46 0.06
47 0.07
48 0.09
49 0.09
50 0.1
51 0.1
52 0.1
53 0.11
54 0.12
55 0.13
56 0.11
57 0.13
58 0.15
59 0.16
60 0.16
61 0.16
62 0.18
63 0.18
64 0.23
65 0.3
66 0.27
67 0.29
68 0.31
69 0.33
70 0.33
71 0.35
72 0.31
73 0.26
74 0.29
75 0.26
76 0.24
77 0.26