Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7S711

Protein Details
Accession R7S711   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
66-86AIPIPSRKGKKPKLQGPPVEQHydrophilic
NLS Segment(s)
PositionSequence
72-78RKGKKPK
Subcellular Location(s) nucl 12, cyto 10, pero 2, mito 1, plas 1, vacu 1
Family & Domain DBs
KEGG tvs:TRAVEDRAFT_54612  -  
Amino Acid Sequences MKVMADQQASVLRDMKTVQEKQADALAAMAGSRKAAPSTSRPGRRTNAEDEMDIDDGELADDEEAAIPIPSRKGKKPKLQGPPVEQDPQRKKFLVRSNYEGVYGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.28
4 0.29
5 0.32
6 0.34
7 0.34
8 0.34
9 0.36
10 0.3
11 0.22
12 0.2
13 0.15
14 0.09
15 0.09
16 0.08
17 0.05
18 0.05
19 0.05
20 0.05
21 0.06
22 0.07
23 0.1
24 0.15
25 0.24
26 0.32
27 0.41
28 0.43
29 0.47
30 0.5
31 0.53
32 0.52
33 0.48
34 0.46
35 0.39
36 0.36
37 0.33
38 0.3
39 0.25
40 0.21
41 0.15
42 0.08
43 0.07
44 0.06
45 0.05
46 0.03
47 0.02
48 0.02
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.04
56 0.08
57 0.13
58 0.17
59 0.25
60 0.35
61 0.45
62 0.54
63 0.64
64 0.71
65 0.76
66 0.82
67 0.82
68 0.79
69 0.78
70 0.73
71 0.7
72 0.64
73 0.63
74 0.63
75 0.61
76 0.59
77 0.53
78 0.51
79 0.53
80 0.6
81 0.59
82 0.57
83 0.58
84 0.59
85 0.58