Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7S7T9

Protein Details
Accession R7S7T9    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
52-71EYPKESRRGQHKRGTRAARVBasic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.166, nucl 11, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG tvs:TRAVEDRAFT_84536  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences GEGDGAEGRDTEKKKPIMACLFCRERKIACGPPPPGGPHRCNQCTRRDLVCEYPKESRRGQHKRGTRAARVEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.44
4 0.47
5 0.51
6 0.52
7 0.52
8 0.57
9 0.55
10 0.55
11 0.48
12 0.4
13 0.38
14 0.39
15 0.38
16 0.37
17 0.43
18 0.42
19 0.43
20 0.44
21 0.42
22 0.41
23 0.39
24 0.35
25 0.32
26 0.39
27 0.4
28 0.45
29 0.46
30 0.49
31 0.48
32 0.49
33 0.48
34 0.44
35 0.43
36 0.46
37 0.5
38 0.44
39 0.45
40 0.49
41 0.5
42 0.51
43 0.51
44 0.49
45 0.52
46 0.59
47 0.63
48 0.64
49 0.68
50 0.73
51 0.8
52 0.8
53 0.77