Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4X117

Protein Details
Accession Q4X117    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
325-345HEAIRKRALRKAEREKGKKSTBasic
NLS Segment(s)
PositionSequence
328-345IRKRALRKAEREKGKKST
Subcellular Location(s) mito 11, cyto 8, extr 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027533  3_ketoreductase_fungal  
IPR036291  NAD(P)-bd_dom_sf  
IPR020904  Sc_DH/Rdtase_CS  
IPR002347  SDR_fam  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0005789  C:endoplasmic reticulum membrane  
GO:0102339  F:3-oxo-arachidoyl-CoA reductase activity  
GO:0102340  F:3-oxo-behenoyl-CoA reductase activity  
GO:0102342  F:3-oxo-cerotoyl-CoA reductase activity  
GO:0102341  F:3-oxo-lignoceroyl-CoA reductase activity  
GO:0045703  F:ketoreductase activity  
GO:0030497  P:fatty acid elongation  
GO:1901362  P:organic cyclic compound biosynthetic process  
GO:0044550  P:secondary metabolite biosynthetic process  
GO:0030148  P:sphingolipid biosynthetic process  
GO:0042761  P:very long-chain fatty acid biosynthetic process  
KEGG afm:AFUA_2G11540  -  
Pfam View protein in Pfam  
PF00106  adh_short  
PROSITE View protein in PROSITE  
PS00061  ADH_SHORT  
CDD cd05356  17beta-HSD1_like_SDR_c  
Amino Acid Sequences MEFLSKYTACLSNWGLNLEPGLQTVGAAVLLTTGTLFIASRVLTFVRVLLSLFVLPGKPLRSFGPKGSWAVVTGASDGLGKEFSLQLARAGFNIVLVSRTASKLTTLAEEITTKHSVQTKTLAMDYAANNDADYEELKAIVDGLDVAVLINNVGKSHDIPTPFALTPEDEMTDIVTINCLGTLRTTQLIIPGMMQRKRGLVLTMGSFGGLLPTPLLATYSGSKAFLQQWSTSLGSELEPYGITVELVQAYLITSAMSKVRRTSATIPDPRAFVKAVLSKIGRNGGSPGYAYSSSPYWSHGLMAWFLTCVMQPMGKLVVGQNKSMHEAIRKRALRKAEREKGKKST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.29
3 0.26
4 0.27
5 0.23
6 0.19
7 0.13
8 0.13
9 0.1
10 0.09
11 0.09
12 0.08
13 0.06
14 0.06
15 0.05
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.03
22 0.04
23 0.04
24 0.04
25 0.06
26 0.07
27 0.07
28 0.09
29 0.09
30 0.1
31 0.1
32 0.11
33 0.1
34 0.1
35 0.1
36 0.1
37 0.1
38 0.09
39 0.09
40 0.1
41 0.08
42 0.09
43 0.12
44 0.14
45 0.13
46 0.15
47 0.19
48 0.26
49 0.29
50 0.32
51 0.37
52 0.38
53 0.39
54 0.39
55 0.36
56 0.29
57 0.27
58 0.24
59 0.17
60 0.14
61 0.12
62 0.1
63 0.1
64 0.08
65 0.08
66 0.07
67 0.06
68 0.06
69 0.07
70 0.07
71 0.09
72 0.09
73 0.1
74 0.12
75 0.12
76 0.11
77 0.13
78 0.11
79 0.1
80 0.1
81 0.08
82 0.07
83 0.07
84 0.08
85 0.08
86 0.09
87 0.1
88 0.09
89 0.1
90 0.11
91 0.12
92 0.12
93 0.11
94 0.11
95 0.12
96 0.12
97 0.13
98 0.16
99 0.17
100 0.15
101 0.17
102 0.22
103 0.22
104 0.23
105 0.26
106 0.24
107 0.24
108 0.24
109 0.22
110 0.16
111 0.19
112 0.18
113 0.16
114 0.15
115 0.13
116 0.12
117 0.12
118 0.12
119 0.09
120 0.09
121 0.06
122 0.05
123 0.06
124 0.06
125 0.05
126 0.05
127 0.05
128 0.04
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.04
138 0.04
139 0.04
140 0.04
141 0.05
142 0.06
143 0.08
144 0.11
145 0.11
146 0.12
147 0.14
148 0.17
149 0.17
150 0.16
151 0.14
152 0.12
153 0.13
154 0.12
155 0.11
156 0.07
157 0.07
158 0.07
159 0.07
160 0.06
161 0.05
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.03
168 0.04
169 0.05
170 0.06
171 0.06
172 0.07
173 0.07
174 0.09
175 0.1
176 0.09
177 0.1
178 0.13
179 0.18
180 0.19
181 0.21
182 0.19
183 0.2
184 0.2
185 0.2
186 0.17
187 0.13
188 0.12
189 0.12
190 0.13
191 0.12
192 0.11
193 0.1
194 0.09
195 0.08
196 0.06
197 0.05
198 0.03
199 0.04
200 0.04
201 0.04
202 0.05
203 0.04
204 0.06
205 0.07
206 0.09
207 0.09
208 0.11
209 0.11
210 0.13
211 0.15
212 0.17
213 0.18
214 0.17
215 0.17
216 0.2
217 0.21
218 0.18
219 0.16
220 0.14
221 0.12
222 0.12
223 0.11
224 0.08
225 0.07
226 0.07
227 0.07
228 0.06
229 0.06
230 0.05
231 0.06
232 0.05
233 0.05
234 0.05
235 0.04
236 0.05
237 0.05
238 0.05
239 0.04
240 0.04
241 0.05
242 0.09
243 0.12
244 0.13
245 0.15
246 0.2
247 0.21
248 0.26
249 0.31
250 0.37
251 0.45
252 0.5
253 0.53
254 0.51
255 0.51
256 0.47
257 0.43
258 0.34
259 0.25
260 0.24
261 0.24
262 0.23
263 0.28
264 0.28
265 0.27
266 0.3
267 0.35
268 0.29
269 0.25
270 0.26
271 0.22
272 0.22
273 0.21
274 0.18
275 0.17
276 0.17
277 0.17
278 0.16
279 0.16
280 0.17
281 0.17
282 0.18
283 0.16
284 0.15
285 0.16
286 0.17
287 0.17
288 0.17
289 0.17
290 0.15
291 0.13
292 0.13
293 0.12
294 0.1
295 0.1
296 0.1
297 0.1
298 0.1
299 0.12
300 0.14
301 0.13
302 0.14
303 0.16
304 0.24
305 0.24
306 0.27
307 0.28
308 0.29
309 0.33
310 0.33
311 0.33
312 0.32
313 0.37
314 0.42
315 0.49
316 0.53
317 0.52
318 0.57
319 0.64
320 0.65
321 0.7
322 0.74
323 0.73
324 0.79
325 0.84