Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C7MY56

Protein Details
Accession A0A0C7MY56    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
81-105ATLPFASQFKKRKNIKKLRSVLLKEHydrophilic
NLS Segment(s)
PositionSequence
91-96KRKNIK
Subcellular Location(s) plas 14, E.R. 6, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001142  DUP/COS  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00674  DUP  
Amino Acid Sequences MLRESQSFRQSSDVSQLPAKFFSSKLSWRLHDLANARYFYVWLFALAIFPVVTTSIVKKTGTWSSSITKFTVFVSAEIVLATLPFASQFKKRKNIKKLRSVLLKEVVELESDFAHKHWDLIAKHVNEYLLQEGLWHSEHCIYDGEECLRYFRDQVYLPFVVNPSEKHDEQLATQIYEKSYEIYWSSQELITKIAALEPNQNLPRDTYRFSIVYDLIHGIKPALKFLPVVVLSSLYMKWKMSLKIIATASVFGFLKLMCSSCHLTRRSRGRALSQPLHILTLLKLEYHSEPGESANKWDEVAKKMNTYLNEEGVLPDKRVFFDGKQCHAKFESLLAATLPDDDIKKSLYPELIRFASEFRAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.37
4 0.34
5 0.34
6 0.34
7 0.28
8 0.25
9 0.28
10 0.29
11 0.32
12 0.38
13 0.42
14 0.42
15 0.47
16 0.51
17 0.47
18 0.47
19 0.44
20 0.45
21 0.44
22 0.42
23 0.37
24 0.33
25 0.31
26 0.24
27 0.23
28 0.15
29 0.1
30 0.1
31 0.1
32 0.1
33 0.1
34 0.1
35 0.07
36 0.07
37 0.07
38 0.06
39 0.07
40 0.07
41 0.1
42 0.13
43 0.16
44 0.16
45 0.17
46 0.21
47 0.27
48 0.27
49 0.27
50 0.27
51 0.31
52 0.36
53 0.37
54 0.33
55 0.27
56 0.27
57 0.25
58 0.27
59 0.21
60 0.16
61 0.17
62 0.16
63 0.15
64 0.14
65 0.14
66 0.07
67 0.07
68 0.06
69 0.04
70 0.03
71 0.04
72 0.05
73 0.08
74 0.16
75 0.24
76 0.32
77 0.42
78 0.52
79 0.62
80 0.72
81 0.81
82 0.83
83 0.85
84 0.86
85 0.85
86 0.85
87 0.79
88 0.74
89 0.7
90 0.61
91 0.5
92 0.44
93 0.35
94 0.26
95 0.22
96 0.16
97 0.09
98 0.1
99 0.09
100 0.07
101 0.11
102 0.1
103 0.1
104 0.12
105 0.18
106 0.18
107 0.24
108 0.31
109 0.28
110 0.29
111 0.3
112 0.28
113 0.21
114 0.22
115 0.17
116 0.1
117 0.09
118 0.09
119 0.08
120 0.09
121 0.1
122 0.08
123 0.08
124 0.11
125 0.11
126 0.12
127 0.13
128 0.12
129 0.12
130 0.14
131 0.14
132 0.12
133 0.13
134 0.13
135 0.13
136 0.13
137 0.13
138 0.12
139 0.14
140 0.14
141 0.15
142 0.2
143 0.19
144 0.19
145 0.19
146 0.18
147 0.16
148 0.16
149 0.15
150 0.15
151 0.19
152 0.19
153 0.19
154 0.21
155 0.19
156 0.19
157 0.24
158 0.19
159 0.15
160 0.16
161 0.16
162 0.14
163 0.15
164 0.14
165 0.1
166 0.09
167 0.09
168 0.09
169 0.09
170 0.1
171 0.09
172 0.11
173 0.1
174 0.11
175 0.1
176 0.1
177 0.1
178 0.09
179 0.08
180 0.08
181 0.08
182 0.09
183 0.13
184 0.12
185 0.18
186 0.2
187 0.2
188 0.19
189 0.2
190 0.24
191 0.22
192 0.24
193 0.2
194 0.21
195 0.21
196 0.21
197 0.22
198 0.18
199 0.15
200 0.14
201 0.14
202 0.12
203 0.11
204 0.11
205 0.09
206 0.11
207 0.11
208 0.11
209 0.11
210 0.1
211 0.1
212 0.1
213 0.16
214 0.13
215 0.14
216 0.12
217 0.12
218 0.12
219 0.13
220 0.14
221 0.09
222 0.1
223 0.1
224 0.12
225 0.15
226 0.17
227 0.19
228 0.22
229 0.22
230 0.27
231 0.28
232 0.27
233 0.23
234 0.23
235 0.19
236 0.18
237 0.17
238 0.1
239 0.1
240 0.08
241 0.09
242 0.09
243 0.1
244 0.08
245 0.11
246 0.15
247 0.19
248 0.27
249 0.29
250 0.33
251 0.41
252 0.51
253 0.55
254 0.58
255 0.57
256 0.57
257 0.62
258 0.66
259 0.63
260 0.56
261 0.52
262 0.46
263 0.44
264 0.36
265 0.28
266 0.2
267 0.18
268 0.16
269 0.12
270 0.12
271 0.13
272 0.14
273 0.17
274 0.17
275 0.14
276 0.14
277 0.16
278 0.21
279 0.18
280 0.2
281 0.19
282 0.19
283 0.19
284 0.23
285 0.24
286 0.25
287 0.32
288 0.31
289 0.31
290 0.34
291 0.37
292 0.36
293 0.39
294 0.37
295 0.32
296 0.3
297 0.28
298 0.26
299 0.27
300 0.27
301 0.21
302 0.21
303 0.2
304 0.2
305 0.23
306 0.25
307 0.22
308 0.31
309 0.37
310 0.42
311 0.51
312 0.51
313 0.53
314 0.52
315 0.51
316 0.42
317 0.38
318 0.35
319 0.26
320 0.26
321 0.21
322 0.2
323 0.18
324 0.17
325 0.15
326 0.11
327 0.11
328 0.12
329 0.13
330 0.15
331 0.17
332 0.18
333 0.22
334 0.26
335 0.29
336 0.31
337 0.37
338 0.36
339 0.36
340 0.34
341 0.32