Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C7MWT8

Protein Details
Accession A0A0C7MWT8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
93-119AERRILPKPSRRSRQQQKRPRSRTLTAHydrophilic
NLS Segment(s)
PositionSequence
96-113RILPKPSRRSRQQQKRPR
Subcellular Location(s) cyto_nucl 14.333, cyto 14, nucl 10.5, mito_nucl 6.332
Family & Domain DBs
InterPro View protein in InterPro  
IPR000554  Ribosomal_S7e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01251  Ribosomal_S7e  
PROSITE View protein in PROSITE  
PS00948  RIBOSOMAL_S7E  
Amino Acid Sequences MSAQAKILSQAPTELELQVAQAFVDLEAASPDAKADLRPLQFKSIREIEVGGGKKAIAIFVPVPSLAGYHKVQTKLTRELEKKFPDRHVIFLAERRILPKPSRRSRQQQKRPRSRTLTAVHDKILEDLVFPTEIVGKRVRYLVGGNKVQKVLLDSKDVQQVDYKLESFQAVYNKLTGKQIVFEIPGESH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.13
4 0.13
5 0.12
6 0.1
7 0.08
8 0.07
9 0.07
10 0.06
11 0.07
12 0.06
13 0.05
14 0.06
15 0.07
16 0.06
17 0.06
18 0.06
19 0.06
20 0.07
21 0.07
22 0.11
23 0.17
24 0.2
25 0.25
26 0.27
27 0.34
28 0.38
29 0.38
30 0.41
31 0.39
32 0.37
33 0.33
34 0.32
35 0.25
36 0.28
37 0.28
38 0.21
39 0.17
40 0.16
41 0.16
42 0.15
43 0.14
44 0.07
45 0.08
46 0.08
47 0.08
48 0.09
49 0.08
50 0.08
51 0.08
52 0.09
53 0.07
54 0.1
55 0.1
56 0.12
57 0.16
58 0.18
59 0.2
60 0.24
61 0.29
62 0.32
63 0.36
64 0.41
65 0.41
66 0.44
67 0.5
68 0.51
69 0.52
70 0.48
71 0.47
72 0.47
73 0.45
74 0.43
75 0.38
76 0.34
77 0.29
78 0.3
79 0.29
80 0.21
81 0.21
82 0.2
83 0.2
84 0.2
85 0.23
86 0.28
87 0.36
88 0.44
89 0.52
90 0.57
91 0.66
92 0.74
93 0.81
94 0.83
95 0.83
96 0.85
97 0.89
98 0.89
99 0.87
100 0.83
101 0.74
102 0.72
103 0.67
104 0.65
105 0.6
106 0.55
107 0.46
108 0.4
109 0.38
110 0.3
111 0.26
112 0.16
113 0.1
114 0.09
115 0.09
116 0.08
117 0.08
118 0.07
119 0.1
120 0.11
121 0.13
122 0.16
123 0.15
124 0.17
125 0.18
126 0.18
127 0.15
128 0.19
129 0.24
130 0.29
131 0.36
132 0.38
133 0.39
134 0.39
135 0.38
136 0.35
137 0.31
138 0.28
139 0.24
140 0.27
141 0.25
142 0.28
143 0.35
144 0.35
145 0.31
146 0.3
147 0.29
148 0.27
149 0.28
150 0.25
151 0.19
152 0.2
153 0.2
154 0.16
155 0.19
156 0.2
157 0.2
158 0.2
159 0.23
160 0.25
161 0.26
162 0.29
163 0.28
164 0.23
165 0.23
166 0.24
167 0.24
168 0.24
169 0.23