Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C7NBT0

Protein Details
Accession A0A0C7NBT0    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAAPREPRKKTTRRKKDPNAPKRALSBasic
NLS Segment(s)
PositionSequence
5-23REPRKKTTRRKKDPNAPKR
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAAPREPRKKTTRRKKDPNAPKRALSAYMFFANENRDIVRAENPGVTFGQVGRILGEKWKALNDDEKVPYESKAEADKKRYESEKELYNATKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.94
3 0.95
4 0.95
5 0.95
6 0.94
7 0.87
8 0.79
9 0.72
10 0.63
11 0.56
12 0.47
13 0.38
14 0.31
15 0.28
16 0.25
17 0.21
18 0.2
19 0.18
20 0.17
21 0.15
22 0.12
23 0.11
24 0.11
25 0.12
26 0.13
27 0.13
28 0.13
29 0.13
30 0.13
31 0.13
32 0.13
33 0.12
34 0.09
35 0.08
36 0.1
37 0.08
38 0.08
39 0.08
40 0.08
41 0.08
42 0.11
43 0.12
44 0.1
45 0.1
46 0.12
47 0.13
48 0.14
49 0.2
50 0.2
51 0.25
52 0.26
53 0.28
54 0.29
55 0.28
56 0.28
57 0.23
58 0.22
59 0.18
60 0.24
61 0.29
62 0.33
63 0.38
64 0.44
65 0.47
66 0.54
67 0.56
68 0.54
69 0.53
70 0.52
71 0.54
72 0.5
73 0.51