Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C7N3S2

Protein Details
Accession A0A0C7N3S2   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
31-59KETAARKPTLNRPNPRSRAPRRANENGEMHydrophilic
NLS Segment(s)
PositionSequence
36-54RKPTLNRPNPRSRAPRRAN
Subcellular Location(s) nucl 12.5, mito 9, cyto_nucl 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MIVPRKFGQSRRLYSGAISQDFLKNVLERVKETAARKPTLNRPNPRSRAPRRANENGEMGRNHSGKKFGSRSGGFSQGPVTNDSNLSNANGNRKPGINASVMNRQSQFRRRRNGADETTSGDMSSGSTGIMDALDSTSGVQFRSNKFQQTSKQPGRKPRAPRTSQRTVPGQTNSASSVEGIASKVRKSTPSQQYSPDEPTPLGLLKYAPSLAFSSLSKMNSYGLSTLRKNDFPLTRSINLGVATSPSEKPLNVSLTPNSAGFGKYIPASSLALGKERLFKNVAVSPDLSQFERAVQGKYSALSPASQKSFENIAKNAKKRGELVQNSEVVRISLEKSNIDVVSKNLVFNVCSGLKPVSQLEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.54
3 0.51
4 0.42
5 0.37
6 0.32
7 0.32
8 0.32
9 0.31
10 0.26
11 0.19
12 0.21
13 0.26
14 0.26
15 0.24
16 0.29
17 0.33
18 0.37
19 0.38
20 0.43
21 0.45
22 0.45
23 0.47
24 0.5
25 0.54
26 0.59
27 0.66
28 0.68
29 0.7
30 0.78
31 0.81
32 0.82
33 0.83
34 0.82
35 0.83
36 0.82
37 0.83
38 0.8
39 0.84
40 0.81
41 0.75
42 0.73
43 0.65
44 0.6
45 0.51
46 0.46
47 0.43
48 0.39
49 0.36
50 0.31
51 0.32
52 0.29
53 0.38
54 0.39
55 0.36
56 0.43
57 0.42
58 0.46
59 0.45
60 0.5
61 0.41
62 0.37
63 0.36
64 0.31
65 0.3
66 0.28
67 0.26
68 0.2
69 0.22
70 0.22
71 0.19
72 0.17
73 0.17
74 0.17
75 0.18
76 0.25
77 0.26
78 0.27
79 0.28
80 0.29
81 0.29
82 0.27
83 0.29
84 0.23
85 0.24
86 0.26
87 0.33
88 0.33
89 0.33
90 0.32
91 0.31
92 0.35
93 0.42
94 0.48
95 0.48
96 0.56
97 0.59
98 0.65
99 0.69
100 0.71
101 0.67
102 0.61
103 0.54
104 0.49
105 0.45
106 0.37
107 0.3
108 0.21
109 0.16
110 0.11
111 0.1
112 0.06
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.04
124 0.05
125 0.05
126 0.06
127 0.08
128 0.12
129 0.15
130 0.23
131 0.25
132 0.29
133 0.31
134 0.35
135 0.39
136 0.45
137 0.53
138 0.54
139 0.59
140 0.6
141 0.67
142 0.71
143 0.73
144 0.73
145 0.73
146 0.74
147 0.72
148 0.77
149 0.75
150 0.75
151 0.72
152 0.66
153 0.61
154 0.53
155 0.51
156 0.44
157 0.38
158 0.29
159 0.26
160 0.23
161 0.18
162 0.16
163 0.11
164 0.09
165 0.08
166 0.07
167 0.07
168 0.07
169 0.08
170 0.08
171 0.1
172 0.1
173 0.13
174 0.17
175 0.26
176 0.34
177 0.4
178 0.42
179 0.46
180 0.49
181 0.5
182 0.51
183 0.42
184 0.33
185 0.26
186 0.25
187 0.21
188 0.17
189 0.13
190 0.08
191 0.08
192 0.07
193 0.08
194 0.08
195 0.07
196 0.08
197 0.08
198 0.09
199 0.1
200 0.09
201 0.11
202 0.14
203 0.14
204 0.13
205 0.13
206 0.13
207 0.13
208 0.13
209 0.12
210 0.13
211 0.17
212 0.17
213 0.22
214 0.24
215 0.24
216 0.25
217 0.29
218 0.3
219 0.27
220 0.33
221 0.33
222 0.32
223 0.32
224 0.31
225 0.27
226 0.23
227 0.22
228 0.16
229 0.11
230 0.11
231 0.13
232 0.12
233 0.13
234 0.13
235 0.13
236 0.15
237 0.18
238 0.21
239 0.19
240 0.22
241 0.21
242 0.23
243 0.25
244 0.22
245 0.19
246 0.15
247 0.14
248 0.12
249 0.11
250 0.09
251 0.09
252 0.09
253 0.09
254 0.1
255 0.11
256 0.11
257 0.14
258 0.13
259 0.15
260 0.16
261 0.17
262 0.23
263 0.23
264 0.26
265 0.24
266 0.24
267 0.27
268 0.29
269 0.3
270 0.24
271 0.25
272 0.24
273 0.27
274 0.28
275 0.24
276 0.21
277 0.2
278 0.18
279 0.23
280 0.23
281 0.2
282 0.19
283 0.2
284 0.2
285 0.2
286 0.2
287 0.16
288 0.15
289 0.15
290 0.17
291 0.22
292 0.24
293 0.25
294 0.24
295 0.26
296 0.32
297 0.35
298 0.37
299 0.34
300 0.42
301 0.49
302 0.54
303 0.58
304 0.55
305 0.54
306 0.52
307 0.56
308 0.57
309 0.55
310 0.58
311 0.56
312 0.57
313 0.55
314 0.53
315 0.44
316 0.33
317 0.28
318 0.21
319 0.18
320 0.18
321 0.2
322 0.19
323 0.2
324 0.25
325 0.25
326 0.25
327 0.23
328 0.2
329 0.27
330 0.27
331 0.25
332 0.23
333 0.24
334 0.22
335 0.22
336 0.26
337 0.19
338 0.18
339 0.21
340 0.21
341 0.21
342 0.23