Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C7NEX6

Protein Details
Accession A0A0C7NEX6    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
222-249RFLPMFKKRNVARKKPKNVKVKETKVYTHydrophilic
268-292EYFLSKKEKDAKKLDERKKEQALKQHydrophilic
NLS Segment(s)
PositionSequence
228-242KKRNVARKKPKNVKV
274-292KEKDAKKLDERKKEQALKQ
295-295K
316-335KKRSRSGADAKDESKKKSKA
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR041174  KH_8  
IPR004087  KH_dom  
IPR036612  KH_dom_type_1_sf  
IPR024166  rRNA_assembly_KRR1  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF17903  KH_8  
CDD cd22393  KH-I_KRR1_rpt1  
cd22394  KH-I_KRR1_rpt2  
Amino Acid Sequences MPSTHNKDKPWDTPDIDKWTIAEFLPEDNASGLPFSEESSFMTLFPKYREVYLRSVWNDVTRALDKFHVSCVLDLVEGSMTVKTTRKTFDPAVILKARDLIKLLARSVPFPQAVKILQDDMACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYVLVQGNTVSAMGPFKGLKEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNVKVKETKVYTPFPPAQLPRKVDLQIESGEYFLSKKEKDAKKLDERKKEQALKQVEKEKERAKDYEAPSESEYQGSSKKRSRSGADAKDESKKKSKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.63
3 0.57
4 0.5
5 0.45
6 0.39
7 0.37
8 0.28
9 0.23
10 0.15
11 0.15
12 0.18
13 0.17
14 0.15
15 0.15
16 0.15
17 0.12
18 0.12
19 0.1
20 0.08
21 0.08
22 0.09
23 0.1
24 0.1
25 0.12
26 0.15
27 0.15
28 0.14
29 0.16
30 0.17
31 0.17
32 0.2
33 0.23
34 0.2
35 0.24
36 0.3
37 0.32
38 0.36
39 0.39
40 0.44
41 0.41
42 0.43
43 0.4
44 0.37
45 0.34
46 0.29
47 0.29
48 0.24
49 0.23
50 0.21
51 0.23
52 0.23
53 0.22
54 0.23
55 0.23
56 0.21
57 0.2
58 0.2
59 0.17
60 0.15
61 0.14
62 0.12
63 0.08
64 0.07
65 0.07
66 0.06
67 0.06
68 0.08
69 0.11
70 0.12
71 0.15
72 0.18
73 0.19
74 0.25
75 0.26
76 0.3
77 0.34
78 0.34
79 0.38
80 0.38
81 0.36
82 0.31
83 0.34
84 0.29
85 0.23
86 0.23
87 0.18
88 0.2
89 0.21
90 0.22
91 0.21
92 0.21
93 0.22
94 0.22
95 0.24
96 0.21
97 0.19
98 0.19
99 0.18
100 0.18
101 0.18
102 0.17
103 0.15
104 0.15
105 0.15
106 0.14
107 0.12
108 0.13
109 0.12
110 0.1
111 0.09
112 0.08
113 0.08
114 0.08
115 0.07
116 0.1
117 0.1
118 0.12
119 0.18
120 0.19
121 0.22
122 0.27
123 0.32
124 0.32
125 0.42
126 0.51
127 0.51
128 0.59
129 0.61
130 0.64
131 0.67
132 0.71
133 0.7
134 0.62
135 0.63
136 0.55
137 0.51
138 0.42
139 0.34
140 0.26
141 0.18
142 0.15
143 0.11
144 0.1
145 0.13
146 0.13
147 0.13
148 0.12
149 0.11
150 0.12
151 0.1
152 0.1
153 0.09
154 0.09
155 0.09
156 0.09
157 0.09
158 0.07
159 0.06
160 0.06
161 0.05
162 0.05
163 0.05
164 0.05
165 0.11
166 0.12
167 0.14
168 0.21
169 0.25
170 0.25
171 0.3
172 0.3
173 0.28
174 0.36
175 0.34
176 0.28
177 0.29
178 0.28
179 0.25
180 0.24
181 0.22
182 0.16
183 0.2
184 0.24
185 0.26
186 0.25
187 0.24
188 0.3
189 0.3
190 0.33
191 0.3
192 0.26
193 0.23
194 0.32
195 0.36
196 0.33
197 0.35
198 0.33
199 0.33
200 0.35
201 0.35
202 0.27
203 0.29
204 0.29
205 0.28
206 0.27
207 0.25
208 0.22
209 0.2
210 0.21
211 0.21
212 0.27
213 0.31
214 0.33
215 0.41
216 0.46
217 0.56
218 0.64
219 0.69
220 0.71
221 0.75
222 0.83
223 0.85
224 0.9
225 0.9
226 0.87
227 0.87
228 0.86
229 0.84
230 0.81
231 0.76
232 0.73
233 0.68
234 0.65
235 0.56
236 0.53
237 0.47
238 0.41
239 0.42
240 0.41
241 0.44
242 0.47
243 0.49
244 0.44
245 0.46
246 0.45
247 0.41
248 0.38
249 0.33
250 0.27
251 0.26
252 0.23
253 0.19
254 0.17
255 0.15
256 0.13
257 0.12
258 0.16
259 0.13
260 0.18
261 0.28
262 0.35
263 0.44
264 0.52
265 0.59
266 0.66
267 0.76
268 0.81
269 0.82
270 0.82
271 0.82
272 0.84
273 0.83
274 0.77
275 0.76
276 0.76
277 0.73
278 0.75
279 0.75
280 0.71
281 0.67
282 0.7
283 0.68
284 0.65
285 0.62
286 0.56
287 0.54
288 0.56
289 0.55
290 0.58
291 0.52
292 0.48
293 0.46
294 0.48
295 0.42
296 0.34
297 0.31
298 0.23
299 0.28
300 0.3
301 0.35
302 0.38
303 0.45
304 0.51
305 0.57
306 0.61
307 0.64
308 0.7
309 0.71
310 0.73
311 0.73
312 0.7
313 0.73
314 0.72
315 0.68