Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C7MSH9

Protein Details
Accession A0A0C7MSH9   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AASIPHPKIVKKHTKKFKRHHSDRYHRVAENBasic
NLS Segment(s)
PositionSequence
9-28KIVKKHTKKFKRHHSDRYHR
Subcellular Location(s) mito 14.5, mito_nucl 11.5, nucl 7.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASIPHPKIVKKHTKKFKRHHSDRYHRVAENWRKQKGIDSVVRRRFRGNISEPTIGYGSNKKTKFMRPSGHKTFLVANGKDLELLVMHTKTYAAEIAHNVSSKNRVSLLARAKALGVTVTNPNGRLGLSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.8
3 0.88
4 0.91
5 0.92
6 0.92
7 0.92
8 0.92
9 0.92
10 0.93
11 0.92
12 0.9
13 0.85
14 0.74
15 0.69
16 0.69
17 0.68
18 0.68
19 0.67
20 0.6
21 0.55
22 0.54
23 0.56
24 0.52
25 0.49
26 0.46
27 0.46
28 0.53
29 0.62
30 0.66
31 0.6
32 0.55
33 0.51
34 0.47
35 0.46
36 0.42
37 0.41
38 0.42
39 0.43
40 0.41
41 0.39
42 0.36
43 0.28
44 0.23
45 0.19
46 0.18
47 0.23
48 0.24
49 0.24
50 0.27
51 0.34
52 0.39
53 0.42
54 0.46
55 0.47
56 0.56
57 0.61
58 0.64
59 0.57
60 0.51
61 0.46
62 0.45
63 0.43
64 0.34
65 0.28
66 0.24
67 0.24
68 0.23
69 0.2
70 0.13
71 0.07
72 0.08
73 0.08
74 0.07
75 0.07
76 0.07
77 0.08
78 0.07
79 0.08
80 0.09
81 0.07
82 0.09
83 0.1
84 0.13
85 0.15
86 0.16
87 0.15
88 0.15
89 0.2
90 0.19
91 0.19
92 0.17
93 0.18
94 0.2
95 0.28
96 0.35
97 0.36
98 0.36
99 0.34
100 0.33
101 0.31
102 0.29
103 0.22
104 0.15
105 0.12
106 0.15
107 0.19
108 0.21
109 0.21
110 0.22
111 0.21