Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C7N5D2

Protein Details
Accession A0A0C7N5D2    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
79-108MNEARKRRGKGAPTKKKEASKDKGKTKKRKBasic
NLS Segment(s)
PositionSequence
82-108ARKRRGKGAPTKKKEASKDKGKTKKRK
Subcellular Location(s) mito 18, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSIPKQRLLQVASLSARIFNENFNPTAARNGGKILSKRLKGASIAGYYGNPDFLKFKHLKTLYPEFQFTDEQEEYRLSMNEARKRRGKGAPTKKKEASKDKGKTKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.25
3 0.23
4 0.21
5 0.19
6 0.16
7 0.2
8 0.2
9 0.21
10 0.21
11 0.21
12 0.19
13 0.22
14 0.22
15 0.17
16 0.15
17 0.16
18 0.18
19 0.21
20 0.22
21 0.27
22 0.33
23 0.33
24 0.35
25 0.35
26 0.34
27 0.3
28 0.31
29 0.26
30 0.19
31 0.19
32 0.17
33 0.15
34 0.14
35 0.13
36 0.12
37 0.08
38 0.08
39 0.08
40 0.08
41 0.14
42 0.15
43 0.15
44 0.23
45 0.24
46 0.25
47 0.31
48 0.39
49 0.38
50 0.39
51 0.4
52 0.32
53 0.33
54 0.32
55 0.26
56 0.25
57 0.2
58 0.18
59 0.18
60 0.17
61 0.15
62 0.16
63 0.16
64 0.1
65 0.15
66 0.23
67 0.29
68 0.35
69 0.41
70 0.46
71 0.5
72 0.56
73 0.58
74 0.6
75 0.64
76 0.69
77 0.74
78 0.76
79 0.81
80 0.81
81 0.82
82 0.82
83 0.81
84 0.8
85 0.79
86 0.81
87 0.83
88 0.86