Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C7NEG1

Protein Details
Accession A0A0C7NEG1   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
20-47GQNLSLKRSTWKKPHRRHKATRQLLTDEHydrophilic
NLS Segment(s)
PositionSequence
30-38WKKPHRRHK
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MNNAKVDFLRTVAAENSLQGQNLSLKRSTWKKPHRRHKATRQLLTDEWKRLTKNPNEKTLLTYFNVEAPPSVYPAKKYCDITGLKANYKSPGNGLRFCNSEVYSLVIKPMAPGIDQEYLKLRGDNVVLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.18
4 0.16
5 0.16
6 0.14
7 0.14
8 0.18
9 0.2
10 0.23
11 0.19
12 0.2
13 0.27
14 0.35
15 0.42
16 0.46
17 0.55
18 0.63
19 0.73
20 0.83
21 0.87
22 0.9
23 0.92
24 0.93
25 0.93
26 0.92
27 0.89
28 0.82
29 0.75
30 0.67
31 0.64
32 0.58
33 0.5
34 0.43
35 0.38
36 0.35
37 0.35
38 0.4
39 0.42
40 0.48
41 0.49
42 0.54
43 0.55
44 0.54
45 0.53
46 0.48
47 0.42
48 0.32
49 0.28
50 0.2
51 0.19
52 0.19
53 0.14
54 0.11
55 0.1
56 0.09
57 0.1
58 0.12
59 0.1
60 0.12
61 0.15
62 0.19
63 0.22
64 0.23
65 0.22
66 0.27
67 0.28
68 0.29
69 0.35
70 0.34
71 0.34
72 0.34
73 0.34
74 0.31
75 0.31
76 0.28
77 0.24
78 0.28
79 0.29
80 0.33
81 0.35
82 0.35
83 0.35
84 0.36
85 0.36
86 0.29
87 0.26
88 0.21
89 0.22
90 0.2
91 0.18
92 0.18
93 0.14
94 0.13
95 0.12
96 0.14
97 0.11
98 0.1
99 0.11
100 0.14
101 0.2
102 0.2
103 0.21
104 0.24
105 0.26
106 0.27
107 0.27
108 0.23
109 0.2